PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr3P30880_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 126aa MW: 14011.7 Da PI: 8.2088 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 74.7 | 1.2e-23 | 36 | 92 | 3 | 59 |
-SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 Dgy+WrKYGqK + + + rsY++C +gC++kk+ve +dp+ v++tY g H+h+ GSMUA_Achr3P30880_001 36 DGYAWRKYGQKFILKIRKNRSYFKCREEGCKAKKRVEWPPSDPSNVKVTYDGVHHHP 92 9*******************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 22.251 | 29 | 94 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 7.8E-25 | 30 | 94 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.24E-23 | 31 | 94 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.6E-24 | 34 | 93 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.6E-21 | 36 | 92 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MDAAAQPTAY LEGEASEEHD PSGTGTVGQS LEMPGDGYAW RKYGQKFILK IRKNRSYFKC 60 REEGCKAKKR VEWPPSDPSN VKVTYDGVHH HPSPQLLSAS YREERAGMAN RYNLVIQVLG 120 PPGDSS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-13 | 31 | 94 | 14 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 5e-13 | 31 | 94 | 14 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018678865.1 | 2e-91 | PREDICTED: probable WRKY transcription factor 45 isoform X2 | ||||
TrEMBL | M0SJA2 | 6e-90 | M0SJA2_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr3P30880_001 | 9e-91 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP10158 | 34 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G55600.1 | 2e-16 | WRKY DNA-binding protein 10 |