PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P12200_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 360aa    MW: 40415.1 Da    PI: 6.4213
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P12200_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.7e-181461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g W++eEde+lv+ ++++G g+W+++++  g+ R++k+c++rw +yl
  GSMUA_Achr3P12200_001 14 KGLWSPEEDEKLVRHITKYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                           678*******************************************97 PP

2Myb_DNA-binding53.74.6e-1767110146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg +++eE++l+vd+++ lG++ W+ Ia+ ++ gRt++++k++w++
  GSMUA_Achr3P12200_001  67 RGTFSQEEEDLIVDLHAALGNR-WSQIAAQLP-GRTDNEIKNYWNS 110
                            899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.909961IPR017930Myb domain
SuperFamilySSF466895.62E-3012108IPR009057Homeodomain-like
SMARTSM007173.0E-131363IPR001005SANT/Myb domain
PfamPF002492.0E-151461IPR001005SANT/Myb domain
CDDcd001677.74E-121761No hitNo description
PROSITE profilePS5129426.31662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2665116IPR009057Homeodomain-like
SMARTSM007171.7E-1566114IPR001005SANT/Myb domain
PfamPF002493.9E-1567110IPR001005SANT/Myb domain
CDDcd001678.98E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRHACCYKQ KLRKGLWSPE EDEKLVRHIT KYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIVD LHAALGNRWS QIAAQLPGRT DNEIKNYWNS CIKKKLRQRG  120
IDPSTHKPLG ETDGREDRET TNSEKTSGSR NPQLLDPASS PNSTRYAPLQ QSNYVACCDA  180
NGTRPIGPPI QPTPPLWFTH DTRLLNADAE LCHEMLPSVV PSISTSMLSS SAELKPMISL  240
PPDSNNSANS TDSSNELELQ SSGTLFDSGI FQWLELLPNK GQIQFDTEPE DLKWSEYLNG  300
TIASTTTNQS QGQSLFGVTK EESQVSVNGL NSWYEEQQLH PPDLYGKDLH QRIPAQPERI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009391930.10.0PREDICTED: uncharacterized protein LOC103977969
TrEMBLM0SDY70.0M0SDY7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P12200_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-92myb domain protein 61