PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr3P00700_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 124aa MW: 13613.8 Da PI: 10.469 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 60.2 | 2.7e-19 | 25 | 59 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+tt TplWR gp+g+k+LCnaCG++yrk+++ GSMUA_Achr3P00700_001 25 CAVCRTTRTPLWRAGPSGPKSLCNACGIRYRKNRR 59 999*****************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.229 | 19 | 57 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 2.5E-16 | 19 | 70 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.33E-13 | 22 | 70 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 7.8E-16 | 23 | 59 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.45E-12 | 24 | 59 | No hit | No description |
Pfam | PF00320 | 4.1E-17 | 25 | 59 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
MDDPSFLMSA GSADPSSSDC PTKSCAVCRT TRTPLWRAGP SGPKSLCNAC GIRYRKNRRV 60 AAPGSKKEKI EVGAPLKLRM LGLWEHRSTI QKQSRRMGWR RSMLGEEEEA AVLLMALSSG 120 LLYA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009391010.1 | 3e-86 | PREDICTED: GATA transcription factor 16 | ||||
Swissprot | Q9FJ10 | 7e-27 | GAT16_ARATH; GATA transcription factor 16 | ||||
TrEMBL | M0SAN8 | 8e-85 | M0SAN8_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr3P00700_001 | 1e-85 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2418 | 38 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49300.1 | 6e-20 | GATA transcription factor 16 |
Publications ? help Back to Top | |||
---|---|---|---|
|