PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr2P03880_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 241aa MW: 27636.9 Da PI: 10.128 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.6 | 2.9e-18 | 36 | 82 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd +l +avkq+ g++Wk+Ia+ ++ gRt+ qc +rwqk+l GSMUA_Achr2P03880_001 36 KGGWTNEEDAILSRAVKQFDGRNWKRIAEAFP-GRTDIQCLHRWQKVL 82 688*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 59.9 | 5.7e-19 | 88 | 134 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde ++++v+++G ++W+ Ia+ + gR +kqc++rw+++l GSMUA_Achr2P03880_001 88 KGSWTKEEDECIIKLVAKHGCKRWSIIAKSLS-GRIGKQCRERWYNHL 134 799*****************************.*************97 PP | |||||||
3 | Myb_DNA-binding | 52 | 1.6e-16 | 140 | 182 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +++WT+eE+ l+ a+k++G++ W+ Ia+++ gR ++++k++w+ GSMUA_Achr2P03880_001 140 KDAWTPEEEVTLIYAHKKYGNK-WAEIAKHLH-GRAENSIKNHWN 182 689*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.4 | 31 | 82 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.14E-16 | 34 | 88 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-15 | 35 | 84 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.1E-15 | 36 | 82 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.0E-23 | 38 | 98 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.98E-13 | 39 | 82 | No hit | No description |
PROSITE profile | PS51294 | 30.152 | 83 | 138 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.21E-30 | 85 | 181 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-16 | 87 | 136 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.6E-18 | 88 | 134 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.11E-15 | 90 | 134 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.3E-26 | 99 | 142 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.699 | 139 | 189 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-14 | 139 | 187 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-14 | 140 | 182 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.78E-11 | 142 | 182 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-22 | 143 | 189 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 241 aa Download sequence Send to blast |
MGPYSCGILY MIGIMIVVFS PYIFRKISGP TRRSTKGGWT NEEDAILSRA VKQFDGRNWK 60 RIAEAFPGRT DIQCLHRWQK VLNPELVKGS WTKEEDECII KLVAKHGCKR WSIIAKSLSG 120 RIGKQCRERW YNHLNPAIKK DAWTPEEEVT LIYAHKKYGN KWAEIAKHLH GRAENSIKNH 180 WNCSLKKKLA SYLSSKSFDQ PSGGSLSFCS CGFTPTVMRY ANCELVFDGR SRSLNTVMND 240 R |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 5e-67 | 36 | 189 | 6 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 5e-67 | 36 | 189 | 6 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Transcription activator involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:26069325}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Constant levels during cell cycle. Activated by CYCB1. {ECO:0000269|PubMed:17287251}. | |||||
UniProt | INDUCTION: Slightly induced by ethylene and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009383798.1 | 1e-130 | PREDICTED: uncharacterized protein LOC103971496 | ||||
Swissprot | Q6R032 | 9e-82 | MB3R5_ARATH; Transcription factor MYB3R-5 | ||||
Swissprot | Q9S7G7 | 5e-81 | MB3R1_ARATH; Transcription factor MYB3R-1 | ||||
TrEMBL | M0S4X9 | 1e-180 | M0S4X9_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr2P03880_001 | 0.0 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2495 | 38 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G32730.2 | 7e-79 | Homeodomain-like protein |
Publications ? help Back to Top | |||
---|---|---|---|
|