PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr1P18610_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 234aa MW: 26095.4 Da PI: 6.8833 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.2 | 2.5e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+teEd++l+ + G +W+++++ g+ R++k+c++rw +yl GSMUA_Achr1P18610_001 14 KGPWSTEEDKKLISFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 44.2 | 4.4e-14 | 70 | 111 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++ E++l +d +++lG++ W++Ia++++ gRt++++k+ w+++ GSMUA_Achr1P18610_001 70 LSPAEEQLVIDFHARLGNR-WSKIAAMLP-GRTDNEIKNLWNTH 111 5899***************.*********.***********997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.6E-20 | 5 | 62 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 11.756 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.17E-25 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.0E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.3E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.01E-8 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 23.712 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-23 | 63 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.5E-11 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.3E-13 | 70 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.91E-9 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 234 aa Download sequence Send to blast |
MGRRPCCDKL GVKKGPWSTE EDKKLISFIL TNGHCCWRAV PKLAGLLRCG KSCRLRWTNY 60 LRPDLKRGLL SPAEEQLVID FHARLGNRWS KIAAMLPGRT DNEIKNLWNT HIKKKLVKMG 120 VDPVTHKPLD RKANSVSSQS TATTESKSDQ QLQSRGTDGQ IQSSENTSSP TEASSNADGA 180 DPLLSCLWED NTSLLDELWQ FPSNEDVDYG SVAGPVWPWD EGSCEWLLDD QALG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-26 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT083735 | 2e-55 | BT083735.2 Zea mays full-length cDNA clone ZM_BFb0033K01 mRNA, complete cds. | |||
GenBank | BT085521 | 2e-55 | BT085521.2 Zea mays full-length cDNA clone ZM_BFc0028P12 mRNA, complete cds. | |||
GenBank | BT085625 | 2e-55 | BT085625.2 Zea mays full-length cDNA clone ZM_BFc0040A03 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009412832.1 | 1e-172 | PREDICTED: protein ODORANT1-like | ||||
Swissprot | Q50EX6 | 2e-92 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | M0S119 | 1e-171 | M0S119_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr1P18610_001 | 1e-171 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP79 | 38 | 563 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G12350.1 | 6e-85 | myb domain protein 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|