PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P17510_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family NAC
Protein Properties Length: 352aa    MW: 40666.8 Da    PI: 6.5638
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P17510_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.12.9e-5671361129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppGfrFhPtdeelv++yL+kkv++++++l ++ik+vd+yk+ePwdL++  k+ + e+++wyfFs++dkky+tg+r+nrat++g+Wk
  GSMUA_Achr11P17510_001   7 VPPGFRFHPTDEELVDYYLRKKVASRRIDL-DIIKDVDLYKIEPWDLQEkcKIGTeEQNDWYFFSHKDKKYPTGTRTNRATTAGFWK 92 
                             69****************************.99**************9524444435559*************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             atg+dk+++s k++l+g++ktLvfykgrap+g+k+dW+mheyrle
  GSMUA_Achr11P17510_001  93 ATGRDKPIYS-KNNLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                             **********.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-604172IPR003441NAC domain
PROSITE profilePS5100559.3337172IPR003441NAC domain
PfamPF023658.0E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MDAFPHVPPG FRFHPTDEEL VDYYLRKKVA SRRIDLDIIK DVDLYKIEPW DLQEKCKIGT  60
EEQNDWYFFS HKDKKYPTGT RTNRATTAGF WKATGRDKPI YSKNNLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN APPQANPAIL LVLKFASMFQ EEGWVVCRVF KKRLAAVRRV  180
SDHDTPCWYD DHASFITELD SAKQISPQPE MAYHQHHHLL PCKPELEVHY HLPHDSFLQL  240
PQLESPKLPM YVSHATAFQS SIIAEEDLIQ SSKQFQIVST YDNTGNINQV VEQVTDWRVL  300
DKFVASQLSH NDICREPNCS NSASDVQTSE KLDAASEYAS TSNSSGQVEL WK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-52617314169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6661700.0KP666170.1 Musa AAB Group cultivar Rasthali vascular related NAC-domain protein 3 (VND3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384088.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-139NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM0RT310.0M0RT31_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P17510_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-131NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]