PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10042102 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 158aa MW: 18380.6 Da PI: 9.4211 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 31.4 | 3.3e-10 | 91 | 125 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp+++++ eLA+++gL+++q+ +WF N+R ++ Lus10042102 91 KWPYPTETDKLELAESTGLDQKQINNWFINQRKRH 125 569*****************************985 PP | |||||||
2 | ELK | 28.4 | 3.6e-10 | 45 | 65 | 1 | 21 |
ELK 1 ELKhqLlrKYsgyLgsLkqEF 21 ELK+ Ll KY+gyL+ LkqEF Lus10042102 45 ELKDKLLDKYGGYLSRLKQEF 65 9*******************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51213 | 10.685 | 45 | 65 | IPR005539 | ELK domain |
SMART | SM01188 | 1.1E-5 | 45 | 66 | IPR005539 | ELK domain |
Pfam | PF03789 | 2.1E-7 | 45 | 65 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.795 | 65 | 128 | IPR001356 | Homeobox domain |
SMART | SM00389 | 3.1E-12 | 67 | 132 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 3.08E-20 | 67 | 140 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.8E-27 | 70 | 130 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 2.0E-17 | 85 | 124 | IPR008422 | Homeobox KN domain |
CDD | cd00086 | 2.03E-11 | 91 | 128 | No hit | No description |
PROSITE pattern | PS00027 | 0 | 103 | 126 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MMYSTNGYNN NVGGGGSSDE DIIMTGGSEV VDGRSHQQLN KEERELKDKL LDKYGGYLSR 60 LKQEFTKKKK KGKLPKEARL LLLNWWNLHY KWPYPTETDK LELAESTGLD QKQINNWFIN 120 QRKRHWKPTE NMHSSVMDTL YGSSVSDQCY PSHHHRY* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10042102 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028068158.1 | 3e-54 | homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 8e-46 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A498I264 | 1e-53 | A0A498I264_MALDO; Uncharacterized protein | ||||
STRING | Lus10042102 | 1e-114 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF620 | 34 | 125 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 6e-42 | KNOTTED1-like homeobox gene 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10042102 |
Publications ? help Back to Top | |||
---|---|---|---|
|