PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lus10028899

Organism

Linum usitatissimum

Taxonomic ID

4006

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum

Family

GRF

Protein Properties

Length: 185aa MW: 21144.9 Da PI: 9.4717

Description

GRF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lus10028899	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRC	66.6	3.4e-21	138	179	1	42
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrks 42 d+epgrCrRtDGKkWRCs++ l+++k+C++H+hrgr ++++s Lus10028899 138 DDEPGRCRRTDGKKWRCSKESLPDHKYCQKHMHRGRLNRNRS 179 68*********************************9766665 PP
2	QLQ	41	6e-15	70	104	3	37
QLQ 3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 FT +Q+q+L Q ++yKy+ a++ vP+ Ll++i++ Lus10028899 70 FTVSQIQELQLQWMIYKYIEAGLRVPQSLLVPIWN 104 9*********************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00951	6.0E-5	68	104	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51666	16.896	69	104	IPR014978	Glutamine-Leucine-Glutamine, QLQ
Pfam	PF08880	1.3E-10	70	103	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51667	23.599	138	184	IPR014977	WRC domain
Pfam	PF08879	3.3E-18	140	179	IPR014977	WRC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0005524	Molecular Function	ATP binding

Sequence ? help Back to Top
Protein Sequence Length: 185 aa Download sequence Send to blast
MENNHSSYQS ESSSLSQRIP TFNIPRLSSD SPTIGLGLGL MTGSGSKDED DHDHDITNLQ 60 LGNSRLGVVF TVSQIQELQL QWMIYKYIEA GLRVPQSLLV PIWNSLHSAV PLINTPTLSL 120 SWTQWREMSR YKKGVELDDE PGRCRRTDGK KWRCSKESLP DHKYCQKHMH RGRLNRNRSR 180 KPVE*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that plays a role in the regulation of meristematic function in leaves, stems and inflorescences (PubMed:24532604). Transcription activator that plays a regulatory role in grain development (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates grain size by promoting cell division and expansion, leading to increased grain length and width (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates the expression of genes promoting cell proliferation (PubMed:26187814, PubMed:26936408). Activates the expression of expansin genes to promote cell expansion and grain size (PubMed:27250747). May promote grain size by activating brassinosteroid responses (PubMed:27250747). Component of a network formed by the microRNA396 (miRNA396), the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation (Probable). Component of the miRNA396c-GRF4-GIF1 regulatory module that plays an important role in grain size determination (Probable) (PubMed:27250747, PubMed:27250749, PubMed:27107174). {ECO:0000269\|PubMed:24532604, ECO:0000269\|PubMed:26187814, ECO:0000269\|PubMed:26936408, ECO:0000269\|PubMed:27107174, ECO:0000269\|PubMed:27250747, ECO:0000269\|PubMed:27250749, ECO:0000305\|PubMed:26187814, ECO:0000305\|PubMed:27107174, ECO:0000305\|PubMed:27250747, ECO:0000305\|PubMed:27250749}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lus10028899

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: The microRNA396c negatively regulates GRF4 at the transcriptional level. {ECO:0000269\|PubMed:26187814, ECO:0000269\|PubMed:26936408, ECO:0000269\|PubMed:27107174, ECO:0000269\|PubMed:27250747}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003537666.1	4e-36	growth-regulating factor 4
Refseq	XP_028188047.1	4e-36	growth-regulating factor 4-like
Swissprot	Q6ZIK5	2e-32	GRF4_ORYSJ; Growth-regulating factor 4
TrEMBL	A0A445M7H1	7e-35	A0A445M7H1_GLYSO; Growth-regulating factor 4 isoform A
STRING	Lus10028899	1e-134	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF14195	10	17

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G36400.1	1e-32	growth-regulating factor 3

Link Out ? help Back to Top
Phytozome	Lus10028899

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Hu J, et al. A Rare Allele of GS2 Enhances Grain Size and Grain Yield in Rice. Mol Plant, 2015. 8(10): p. 1455-65 [PMID:26187814] Sun P, et al. OsGRF4 controls grain shape, panicle length and seed shattering in rice. J Integr Plant Biol, 2016. 58(10): p. 836-847 [PMID:26936408] Li S, et al. The OsmiR396c-OsGRF4-OsGIF1 regulatory module determines grain size and yield in rice. Plant Biotechnol. J., 2016. 14(11): p. 2134-2146 [PMID:27107174] Che R, et al. Control of grain size and rice yield by GL2-mediated brassinosteroid responses. Nat Plants, 2015. 2: p. 15195 [PMID:27250747] Duan P, et al. Regulation of OsGRF4 by OsmiR396 controls grain size and yield in rice. Nat Plants, 2015. 2: p. 15203 [PMID:27250749]