PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10026679 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 232aa MW: 26936.5 Da PI: 8.4726 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.9 | 7.1e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g+ KKA+E+SvLCdaeva+i+fs++gkl+ey++ Lus10026679 9 KRIENKINRQVTFSKRRAGLHKKAHEISVLCDAEVALIVFSHKGKLFEYAT 59 79***********************************************86 PP | |||||||
2 | K-box | 97.7 | 1.8e-32 | 77 | 171 | 3 | 97 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +++ +++e + ++ e+++Lk++ie Lqr++Rh++GedL+++s keLq+LeqqL+++lk+iR+++n+l++e+i lq+kek++qe+n L k+ Lus10026679 77 ERQLVATELDSQGNWLMEYNRLKAKIELLQRNHRHYMGEDLDTMSTKELQNLEQQLDSALKNIRTRRNQLMHESITALQRKEKAIQEQNDVLAKQ 171 55666666677899****************************************************************************99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 7.9E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.777 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.45E-34 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.34E-43 | 2 | 79 | No hit | No description |
PRINTS | PR00404 | 3.4E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.5E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.4E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.4E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.3E-27 | 86 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.794 | 88 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009933 | Biological Process | meristem structural organization | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 232 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRAGLHK KAHEISVLCD AEVALIVFSH KGKLFEYATD 60 SCMEKILERY ERYSYAERQL VATELDSQGN WLMEYNRLKA KIELLQRNHR HYMGEDLDTM 120 STKELQNLEQ QLDSALKNIR TRRNQLMHES ITALQRKEKA IQEQNDVLAK QQSHSPYLLQ 180 HQNPPQQLPC LNVGGSYQEE HHHQGHDARG RNDLDLTLEP IYSCNLGCFA A* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 5e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 5e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 5e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 5e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00096 | ChIP-seq | Transfer from AT1G69120 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10026679 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021623236.1 | 1e-127 | truncated transcription factor CAULIFLOWER A | ||||
Swissprot | Q6E6S7 | 1e-120 | AP1_VITVI; Agamous-like MADS-box protein AP1 | ||||
TrEMBL | A0A061EAI9 | 1e-124 | A0A061EAI9_THECC; K-box region and MADS-box transcription factor family protein | ||||
STRING | Lus10026679 | 1e-173 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF588 | 32 | 119 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 1e-115 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10026679 |
Publications ? help Back to Top | |||
---|---|---|---|
|