PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10012547 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 119aa MW: 13795.6 Da PI: 9.9704 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 107.4 | 6.9e-34 | 39 | 97 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg+H+h+ Lus10012547 39 LDDGYRWRKYGQKAVKNNKFPRSYYRCTYQGCNVKKQVQRLNKDEGVVITTYEGNHTHP 97 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.4E-34 | 24 | 97 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.44E-30 | 31 | 98 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.125 | 34 | 99 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.2E-40 | 39 | 98 | IPR003657 | WRKY domain |
Pfam | PF03106 | 7.2E-28 | 40 | 97 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MEAVAADHIV DHDGGSSGRK KVKKRPKYAF QTRSQVDILD DGYRWRKYGQ KAVKNNKFPR 60 SYYRCTYQGC NVKKQVQRLN KDEGVVITTY EGNHTHPIEK PSENFEHILS QMQIYTPF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-28 | 15 | 98 | 1 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 5e-28 | 15 | 98 | 1 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10012547 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007216937.1 | 1e-63 | probable WRKY transcription factor 45 | ||||
Refseq | XP_021823097.1 | 9e-64 | probable WRKY transcription factor 45 | ||||
Swissprot | Q9FYA2 | 2e-55 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | M5WY44 | 2e-62 | M5WY44_PRUPE; Uncharacterized protein | ||||
STRING | Lus10012547 | 4e-85 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 3e-57 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10012547 |