PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10009939 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 247aa MW: 27966.2 Da PI: 8.7557 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 173.8 | 5.1e-54 | 9 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+evd++k+ePwdL++ ++ + ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++ Lus10009939 9 VPPGFRFHPTDEELLYYYLRKKVSYEAIDL-DVIREVDLNKLEPWDLKEkcRIGTgPQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIHLG 105 69****************************.9***************952444443456*************************************** PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ +g++ktLvfy+grap+g+ktdW+mheyrl Lus10009939 106 NSQRIGMRKTLVFYTGRAPHGHKTDWIMHEYRL 138 *******************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.28E-60 | 5 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 58.09 | 9 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.1E-28 | 10 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003002 | Biological Process | regionalization | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
GO:0010455 | Biological Process | positive regulation of cell fate commitment | ||||
GO:0048829 | Biological Process | root cap development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 247 aa Download sequence Send to blast |
MAGSGQLTVP PGFRFHPTDE ELLYYYLRKK VSYEAIDLDV IREVDLNKLE PWDLKEKCRI 60 GTGPQNEWYF FSHKDKKYPT GTRTNRATAA GFWKATGRDK AIHLGNSQRI GMRKTLVFYT 120 GRAPHGHKTD WIMHEYRLDD DNSDVQEDGW VVCRVFKKKN QVRGYLPQQV LGGGDEDQHH 180 HPAAATPMHN GHRHHIHDLL YNNDHCGAGG FDGSMHLPQL FSAESVAAAA PADGRRRSSS 240 SRSRES* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-53 | 6 | 163 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-53 | 6 | 163 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-53 | 6 | 163 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-53 | 6 | 163 | 14 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-53 | 6 | 163 | 17 | 173 | NAC domain-containing protein 19 |
3swm_B | 3e-53 | 6 | 163 | 17 | 173 | NAC domain-containing protein 19 |
3swm_C | 3e-53 | 6 | 163 | 17 | 173 | NAC domain-containing protein 19 |
3swm_D | 3e-53 | 6 | 163 | 17 | 173 | NAC domain-containing protein 19 |
3swp_A | 3e-53 | 6 | 163 | 17 | 173 | NAC domain-containing protein 19 |
3swp_B | 3e-53 | 6 | 163 | 17 | 173 | NAC domain-containing protein 19 |
3swp_C | 3e-53 | 6 | 163 | 17 | 173 | NAC domain-containing protein 19 |
3swp_D | 3e-53 | 6 | 163 | 17 | 173 | NAC domain-containing protein 19 |
4dul_A | 3e-53 | 6 | 163 | 14 | 170 | NAC domain-containing protein 19 |
4dul_B | 3e-53 | 6 | 163 | 14 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00250 | DAP | Transfer from AT1G79580 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10009939 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002521498.1 | 1e-127 | protein SOMBRERO isoform X2 | ||||
Swissprot | Q9MA17 | 1e-106 | SMB_ARATH; Protein SOMBRERO | ||||
TrEMBL | B9S679 | 1e-126 | B9S679_RICCO; NAC domain-containing protein, putative | ||||
STRING | Lus10009939 | 0.0 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7204 | 34 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G79580.3 | 3e-97 | NAC family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10009939 |
Publications ? help Back to Top | |||
---|---|---|---|
|