PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10009697 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 155aa MW: 17130.6 Da PI: 9.5037 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 106.6 | 3.9e-33 | 81 | 146 | 3 | 68 |
DUF702 3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaa 68 s ta+CqdCGnqakkdC h+RCRtCCksrgfdCathvkstWvp+a+rrerq ++a + s +++s++ Lus10009697 81 SSTATCQDCGNQAKKDCPHRRCRTCCKSRGFDCATHVKSTWVPSARRRERQLMTAPSRSYDTTSSH 146 67899*********************************************9999988776666553 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 2.1E-29 | 83 | 140 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 2.9E-27 | 85 | 127 | IPR006510 | Zinc finger, lateral root primordium type 1 |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MDGGDHDHHH NLFQRKIGSS NSSGIQFWQH YNNSIKKTNP PSSSILDPNN NANNNNNNNN 60 NNPPQSGGVV MNSMMATTSS SSTATCQDCG NQAKKDCPHR RCRTCCKSRG FDCATHVKST 120 WVPSARRRER QLMTAPSRSY DTTSSHHHQD AGFR* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Suppressor of the gibberellin (GA) signal transduction. {ECO:0000269|PubMed:10368174, ECO:0000269|PubMed:11706176, ECO:0000269|PubMed:16740146}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10009697 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021634050.1 | 2e-37 | protein LATERAL ROOT PRIMORDIUM 1-like | ||||
Swissprot | Q9XGX0 | 6e-26 | SHI_ARATH; Protein SHORT INTERNODES | ||||
TrEMBL | A0A2C9WM92 | 4e-36 | A0A2C9WM92_MANES; Uncharacterized protein | ||||
STRING | Lus10009697 | 1e-111 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF25300 | 2 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G12330.3 | 1e-26 | Lateral root primordium (LRP) protein-related |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10009697 |
Publications ? help Back to Top | |||
---|---|---|---|
|