PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10009472 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 172aa MW: 18869.8 Da PI: 8.6347 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 79.2 | 2.9e-25 | 9 | 57 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 krien rqvtf+kRr+g+lKKA+ELSvLCdae+ v++fss+gk ye Lus10009472 9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGVLVFSSHGKHYEL 57 79*******************************************9996 PP | |||||||
2 | K-box | 40.8 | 9.7e-15 | 96 | 160 | 10 | 74 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnelll 74 ++ +++ ++e++ Lk+ei++Lq+ +R + G + ++++l+eL Le++Le + +iRs+K+e +l Lus10009472 96 SKDPNQNAKEEINMLKQEIQMLQKGLRYMFGGGDSEMTLEELLVLEKHLEIWVCQIRSTKSEAIL 160 556689*******************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF55455 | 1.44E-28 | 1 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.436 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.8E-35 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.19E-39 | 2 | 73 | No hit | No description |
PRINTS | PR00404 | 1.7E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.1E-23 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.1E-13 | 96 | 160 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 9.291 | 100 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGVLVFSS HGKHYELATK 60 GTMQGLIDKY MKCSPGSGSG SSSGSDSGAA QPVVESKDPN QNAKEEINML KQEIQMLQKG 120 LRYMFGGGDS EMTLEELLVL EKHLEIWVCQ IRSTKSEAIL TGHVVSFEVN N* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-15 | 1 | 84 | 1 | 83 | MEF2 CHIMERA |
6byy_B | 2e-15 | 1 | 84 | 1 | 83 | MEF2 CHIMERA |
6byy_C | 2e-15 | 1 | 84 | 1 | 83 | MEF2 CHIMERA |
6byy_D | 2e-15 | 1 | 84 | 1 | 83 | MEF2 CHIMERA |
6bz1_A | 2e-15 | 1 | 83 | 1 | 82 | MEF2 CHIMERA |
6bz1_B | 2e-15 | 1 | 83 | 1 | 82 | MEF2 CHIMERA |
6bz1_C | 2e-15 | 1 | 83 | 1 | 82 | MEF2 CHIMERA |
6bz1_D | 2e-15 | 1 | 83 | 1 | 82 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10009472 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006376144.2 | 7e-74 | agamous-like MADS-box protein AGL12 isoform X1 | ||||
Refseq | XP_024439180.1 | 6e-74 | agamous-like MADS-box protein AGL12 isoform X2 | ||||
Swissprot | Q38841 | 3e-66 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
TrEMBL | A0A218W4Q4 | 3e-75 | A0A218W4Q4_PUNGR; Uncharacterized protein | ||||
STRING | Lus10009472 | 1e-124 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7566 | 31 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71692.1 | 3e-63 | AGAMOUS-like 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10009472 |
Publications ? help Back to Top | |||
---|---|---|---|
|