PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10008978 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 207aa MW: 22327.9 Da PI: 5.8216 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 140.5 | 4.5e-44 | 4 | 96 | 3 | 95 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 qd+++P+an+ rim++vlPanaki++dake++q+cvse is vt ea++ cqre+r+t++++dll a++ lGf++yv++l++yl+kyr+ eg Lus10008978 4 RQDEYMPLANILRIMRRVLPANAKITDDAKESIQKCVSELISIVTVEANESCQREHRRTVTAEDLLSAMGRLGFDNYVDTLTLYLEKYRKSEG 96 69***************************************************************************************9886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.9E-38 | 3 | 97 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.06E-31 | 5 | 98 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.8E-20 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.5E-11 | 36 | 54 | No hit | No description |
PRINTS | PR00615 | 2.5E-11 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 2.5E-11 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MPQRQDEYMP LANILRIMRR VLPANAKITD DAKESIQKCV SELISIVTVE ANESCQREHR 60 RTVTAEDLLS AMGRLGFDNY VDTLTLYLEK YRKSEGLDLP APHGDATSLP NPTANRRPNR 120 NLQVQQDPKG NLQVQQGRNG SLQVQQGRNG NFQGQQGEGG NNVNLQLVLY DAEAAAASGL 180 LDGSFGDPLA LRLGSGQASG SGGAQL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-42 | 5 | 93 | 9 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10008978 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ902252 | 0.0 | HQ902252.1 Linum usitatissimum cultivar CDC Bethune putative beta-galactosidase (Bgal1) and putative glycosyl transferase family 1 protein genes, complete cds; putative SUMO-activating enzyme 1A transcript gene, complete cds, alternatively spliced; putative transcription factor H2A superfamily proteins, putative protease, and hypothetical protein genes, complete cds; and putative ATP-binding cassette transporter gene, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004498102.1 | 1e-45 | nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | Q84W66 | 3e-43 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | F6LC72 | 1e-148 | F6LC72_LINUS; Putative transcription factor H2A superfamily protein | ||||
STRING | Lus10008978 | 1e-148 | (Linum usitatissimum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 6e-44 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10008978 |