PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10003366 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 119aa MW: 14078.6 Da PI: 4.3622 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 89.8 | 4.8e-28 | 33 | 111 | 2 | 82 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++a +ew+f+++rd+ky++g+r+nr+t+sgy Lus10003366 33 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPA-MAAIGEEWFFYVPRDRKYRNGDRPNRVTTSGY 111 79***************************.89***************4.455679********************999766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.14E-28 | 32 | 111 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 31.516 | 32 | 118 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.0E-13 | 34 | 117 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MSNEKINSSS SSPPLDDDEE ADQKDEHEND MVMPGFRFHP TEEELVEFYL RRKVEGKRFN 60 VELITFLDLY RYDPWELPAM AAIGEEWFFY VPRDRKYRNG DRPNRVTTSG YLLEGYWG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 8e-28 | 23 | 111 | 6 | 95 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10003366 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ885201 | 7e-51 | HQ885201.1 Linum usitatissimum clone Contig1062 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015891192.1 | 4e-56 | NAC domain-containing protein 35 | ||||
Refseq | XP_021667082.1 | 3e-56 | NAC domain-containing protein 35 isoform X1 | ||||
Refseq | XP_021667083.1 | 3e-56 | NAC domain-containing protein 35 isoform X2 | ||||
Refseq | XP_026664395.1 | 3e-56 | NAC domain-containing protein 35-like isoform X4 | ||||
Swissprot | Q9ZVP8 | 8e-52 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | A0A2I0L2K0 | 2e-55 | A0A2I0L2K0_PUNGR; Uncharacterized protein | ||||
TrEMBL | A0A2U1NA76 | 8e-55 | A0A2U1NA76_ARTAN; No apical meristem (NAM) protein | ||||
TrEMBL | A0A3Q0IFN5 | 7e-55 | A0A3Q0IFN5_PHODC; NAC domain-containing protein 35-like isoform X4 | ||||
STRING | Lus10003366 | 1e-82 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7203 | 31 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.1 | 6e-54 | NAC domain containing protein 35 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10003366 |
Publications ? help Back to Top | |||
---|---|---|---|
|