PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10002058 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 113aa MW: 12252.3 Da PI: 11.9475 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 37.4 | 6e-12 | 28 | 61 | 3 | 37 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegt 37 ++rY eC+kNhAa++Gg+av G +E ++ g++++ Lus10002058 28 SFRYGECQKNHAANIGGYAVHGLREVTAR-GADNK 61 689**********************9998.54433 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 1.0E-7 | 2 | 59 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.1E-8 | 29 | 63 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 10.548 | 31 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MMKKRQVVIK RSEATGRIST TSSPVMGSFR YGECQKNHAA NIGGYAVHGL REVTARGADN 60 KKTAGRPPPS RAPRADATGT STVGRWKRMK WFVSTLLLIT TPLVLVARVK ID* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10002058 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012080548.1 | 9e-21 | mini zinc finger protein 3 | ||||
Swissprot | Q2Q493 | 8e-13 | MIF3_ARATH; Mini zinc finger protein 3 | ||||
TrEMBL | B9RLZ3 | 3e-19 | B9RLZ3_RICCO; Transcription factor, putative | ||||
STRING | Lus10002058 | 3e-77 | (Linum usitatissimum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18835.1 | 1e-14 | mini zinc finger |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10002058 |