PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lsa017793 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 117aa MW: 12220.5 Da PI: 8.1026 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 64.9 | 8.8e-21 | 11 | 45 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+t+kTplWR+gp g+k+LCnaCG++yrkk++ Lsa017793 11 CVDCKTSKTPLWRSGPAGPKSLCNACGIRYRKKRS 45 *********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.637 | 5 | 41 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 2.2E-13 | 5 | 56 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 3.42E-13 | 9 | 46 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 4.0E-17 | 10 | 45 | IPR013088 | Zinc finger, NHR/GATA-type |
PROSITE pattern | PS00344 | 0 | 11 | 36 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 7.15E-15 | 11 | 58 | No hit | No description |
Pfam | PF00320 | 1.3E-18 | 11 | 45 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MESVSCEEKL CVDCKTSKTP LWRSGPAGPK SLCNACGIRY RKKRSPNGSD KRIEKQAPFS 60 PSSSSSSSCS TSAALYSDEV VGDEKAVEDK GGGGRKRGGG VAAAEISDDE EGEGRKG |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 92 | 99 | GGRKRGGG |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023772526.1 | 4e-44 | GATA transcription factor 16-like | ||||
TrEMBL | A0A2J6ME57 | 1e-42 | A0A2J6ME57_LACSA; Uncharacterized protein | ||||
STRING | XP_010094010.1 | 2e-17 | (Morus notabilis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G06740.1 | 5e-19 | GATA transcription factor 15 |