PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lsa009527 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 110aa MW: 12002.6 Da PI: 10.106 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 61.2 | 1.6e-19 | 23 | 78 | 2 | 57 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 kR+ t+ ql +Le+ ++ ++yps+++r++L++ lgLt+rq ++WF+ rR k+kk Lsa009527 23 PKRQMKTPFQLGTLEKTYALEMYPSEATRAKLSETLGLTDRQLQMWFCHRRLKDKK 78 69****************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.7E-19 | 4 | 79 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.48E-18 | 10 | 79 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.309 | 19 | 79 | IPR001356 | Homeobox domain |
SMART | SM00389 | 1.3E-17 | 21 | 83 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 4.0E-17 | 23 | 78 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.96E-14 | 24 | 79 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
METGSEGESN RNINGQSDGS KKPKRQMKTP FQLGTLEKTY ALEMYPSEAT RAKLSETLGL 60 TDRQLQMWFC HRRLKDKKEG TVKRAGGDGG ESLKPSKQEL VVVVSGGGGG |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 71 | 78 | RRLKDKKE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC. {ECO:0000269|PubMed:22694359}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023736728.1 | 9e-68 | homeobox-DDT domain protein RLT1 | ||||
Swissprot | F4HY56 | 1e-29 | RLT1_ARATH; Homeobox-DDT domain protein RLT1 | ||||
TrEMBL | A0A2J6K8Y9 | 2e-66 | A0A2J6K8Y9_LACSA; Uncharacterized protein | ||||
STRING | Migut.M01107.1.p | 2e-35 | (Erythranthe guttata) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G28420.1 | 2e-31 | homeobox-1 |