PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa007460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Nin-like
Protein Properties Length: 569aa    MW: 64650.9 Da    PI: 6.1666
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58688718PU_unrefUnigeneView CDS
PUT-187a-Lactuca_sativa-6535PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.82.4e-29298348252
     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                e +isl+dl++yF +++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Lsa007460 298 ERNISLQDLQQYFPGSLKDAAKSIGVCPTTLKRICRQHGIMRWPSRKIKKV 348
                689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.541287368IPR003035RWP-RK domain
PfamPF020422.0E-26300348IPR003035RWP-RK domain
SuperFamilySSF542776.45E-23475560No hitNo description
Gene3DG3DSA:3.10.20.2402.0E-22477561No hitNo description
SMARTSM006662.6E-24479562IPR000270PB1 domain
PROSITE profilePS5174520.954479562IPR000270PB1 domain
PfamPF005648.3E-18480561IPR000270PB1 domain
CDDcd064073.05E-36480560No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
QAVDLRSSEF LIHPKQKDFS EPYDAVLSEI QDVLRSTCNT LNLPLAQTWG RCEGRSGPIS  60
VIESASYVYD PEILGFFEAA SSQQLVSGEG IAGKALGTNQ PCFTDINDFC RPDYPISSYY  120
GLNAAMAIRL RSTYTGPTDF ILEFFLPRDC KRDDEQKQIG TSIITMIKQI SWSLHLINAE  180
ELMKGMNTRD ESWISDMVEA RERGETVILS MGCQKEEPQE ETNTRDESWI ADMIQARERG  240
EKVILSMGCH KEEPEEEFQV INQFYNGLEN QSFLEWGTGT GLRGQSKRSS IKNRVKTERN  300
ISLQDLQQYF PGSLKDAAKS IGVCPTTLKR ICRQHGIMRW PSRKIKKVSH SLKKLQLVID  360
SVQGAEGMIK LGSFYTNFPE LNSPISPTPK TKVNNRVNHL KKSQTPSNSS SSCSRDSSSS  420
SGNAFPVHTE NVPGSQKRKL PVNQNYNNMN DLLSTPKDKL VDDQRFVEVI PPTQNDEGIF  480
RVKATYGDEK IRFRMSKNWG FGDLHREISK RFNIYDMGNI RIEYIDDDSE WVLLACDDDV  540
EECMDLHTSI NNQTIKLVVH RSTHPSFMW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023751290.10.0protein NLP1-like
TrEMBLA0A2J6M5R10.0A0A2J6M5R1_LACSA; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.21e-107Nin-like family protein