PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa005898
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Nin-like
Protein Properties Length: 195aa    MW: 22070.8 Da    PI: 9.14
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58666399PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.73.5e-263886452
     RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                +s e++s++F++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  Lsa005898 38 ALSRETISQFFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLMSL 86
               6899******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.25719106IPR003035RWP-RK domain
PfamPF020421.5E-213986IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MVRSGYEKPQ KKLDHKGDNG NGYGNNGGCD SNYPSRMALS RETISQFFYM PITQAAKELN  60
VGLTLLKKRC RELGIRRWPH RKLMSLQTLI NNVQELEKSS GNGVEEKLQE AIMRLENERK  120
KMEEIPDLQL EDNTKRLRQA CFKANYKKRK TIGNNSSTSI TTYRQSPSSC SSTCVDNGGY  180
EAIEGGYGGD FAEQE
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023761275.11e-142uncharacterized protein LOC111909726
SwissprotQ9M9U91e-53RKD1_ARATH; Protein RKD1
TrEMBLA0A2J6LJA11e-140A0A2J6LJA1_LACSA; Uncharacterized protein
STRINGXP_004301148.12e-58(Fragaria vesca)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-54RWP-RK domain-containing protein