PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lsa003531 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 161aa MW: 17849.9 Da PI: 4.7741 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 178.5 | 5.9e-56 | 21 | 118 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 vreqdrflPian+srimkk lPan+k +kdaketvqecvsefisf+tseasdkc +ekrktingddllwa+atlGfedy+eplk+yl +yre+eg++k Lsa003531 21 VREQDRFLPIANISRIMKKGLPANGKTAKDAKETVQECVSEFISFITSEASDKCLKEKRKTINGDDLLWAMATLGFEDYIEPLKAYLIRYREIEGDTK 118 69*********************************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.1E-52 | 18 | 137 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.46E-39 | 24 | 149 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.2E-26 | 27 | 91 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.5E-20 | 55 | 73 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 58 | 74 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.5E-20 | 74 | 92 | No hit | No description |
PRINTS | PR00615 | 7.5E-20 | 93 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MAEGPSSPGE SGDLSPRSSN VREQDRFLPI ANISRIMKKG LPANGKTAKD AKETVQECVS 60 EFISFITSEA SDKCLKEKRK TINGDDLLWA MATLGFEDYI EPLKAYLIRY REIEGDTKGS 120 GRKEGVQLQP EHDEGFYSQG LSYGDSQQQG QHLMVPMQGT E |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 4e-45 | 20 | 112 | 1 | 93 | NF-YB |
4awl_B | 3e-45 | 20 | 112 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 3e-45 | 20 | 112 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023744914.1 | 1e-117 | nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | Q8VYK4 | 2e-74 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A2J6JRC7 | 1e-101 | A0A2J6JRC7_LACSA; Uncharacterized protein | ||||
STRING | XP_010244998.1 | 1e-82 | (Nelumbo nucifera) |
Publications ? help Back to Top | |||
---|---|---|---|
|