PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa003256
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Nin-like
Protein Properties Length: 330aa    MW: 36962.2 Da    PI: 7.5677
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-18557PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.62.8e-294797252
     RWP-RK  2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
               ek+i+le+l+++F++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Lsa003256 47 EKSITLEMLRQHFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 97
               799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.88133117IPR003035RWP-RK domain
PfamPF020422.9E-264997IPR003035RWP-RK domain
SuperFamilySSF542772.64E-23229316No hitNo description
PROSITE profilePS5174523.164233314IPR000270PB1 domain
SMARTSM006667.2E-24233316IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.0E-22234313No hitNo description
CDDcd064071.54E-43235315No hitNo description
PfamPF005641.8E-17235314IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
XEEAVNEGLL VVSDIEHVQK IQETTEPGPD PGPGSGTEKR RAGAKMEKSI TLEMLRQHFA  60
GSLKDAAKNI GVCPTTLKRI CRQHGIQRWP SRKIKKVGHS LRKIQLVMDL VHGGSGSFQI  120
ESFYSNFPKL ASQDPSTTTQ LPFAATKTET FDSKGGNTVI SCSQSSSSSH SLSGGTHQAP  180
PVKEDTGDQE QDQDRYQDQD QEQERKLFLG SLNDPPKHQN RPPKPYIKRE GGLWRVKVTF  240
GEEKIRFRLQ KDWGYNDLLQ EIAKRFSLND IGGYQLRYLD DDSEWVLLTC DADVEECIDV  300
YRSFKSGTIR LALREPQIRV GSSLGSNTPL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023730704.10.0protein NLP5-like
RefseqXP_023730705.10.0protein NLP5-like
TrEMBLA0A2J6KMI40.0A0A2J6KMI4_LACSA; Uncharacterized protein
STRINGXP_010692542.17e-84(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.25e-70Nin-like family protein