PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Lsa001515 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
|
||||||||||||
Family | bZIP | ||||||||||||
Protein Properties | Length: 154aa MW: 17364.6 Da PI: 6.5185 | ||||||||||||
Description | bZIP family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 44.7 | 2.9e-14 | 21 | 81 | 3 | 63 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 + ++ rr+++NRe+ArrsR RK++ ++ L + +L +eN + + +++++++ ++++e+ Lsa001515 21 DQRKRRRMISNRESARRSRMRKQKHMDDLMTQLSQLRKENNQVMSSISMITQHFMSVEAEN 81 567889*********************************************9999888876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.6E-13 | 14 | 75 | No hit | No description |
SMART | SM00338 | 8.9E-20 | 19 | 83 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.059 | 21 | 84 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.1E-11 | 22 | 77 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.88E-13 | 23 | 76 | No hit | No description |
CDD | cd14702 | 2.19E-17 | 24 | 75 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 26 | 41 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MASSSGTTTS SGGSDLQGEM DQRKRRRMIS NRESARRSRM RKQKHMDDLM TQLSQLRKEN 60 NQVMSSISMI TQHFMSVEAE NSVLRAQVAE LSHRLHSLND IIAVMKQPID AGSGFAEEQY 120 VGSDTEFGDE FINNSLSFLY ACQPMLASAE MIMY |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 22 | 26 | RKRRR |
2 | 22 | 43 | RKRRRMISNRESARRSRMRKQK |
3 | 35 | 42 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023770439.1 | 1e-111 | bZIP transcription factor 11-like | ||||
Swissprot | O65683 | 1e-39 | BZP11_ARATH; bZIP transcription factor 11 | ||||
TrEMBL | A0A2J6KZ85 | 1e-109 | A0A2J6KZ85_LACSA; Uncharacterized protein | ||||
STRING | GLYMA12G04440.1 | 5e-48 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G34590.1 | 7e-42 | G-box binding factor 6 |