PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LPERR09G00210.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 87aa MW: 9658.32 Da PI: 9.4656 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 73.3 | 4.7e-23 | 7 | 73 | 1 | 67 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAea 67 +Ca+Ck+l+r+C +d v+ pyfpae++++fa vh +FGa nv+k+l+++ r d++sslvyeA + LPERR09G00210.1 7 PCASCKLLQRQCMPDSVFMPYFPAEKAQQFARVHCVFGAINVSKMLHDVLLALRADVVSSLVYEATV 73 7****************************************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 15.198 | 6 | 87 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 7.9E-23 | 7 | 73 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MAGNGTPCAS CKLLQRQCMP DSVFMPYFPA EKAQQFARVH CVFGAINVSK MLHDVLLALR 60 ADVVSSLVYE ATVSPRGIPP HHRRRPH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-22 | 3 | 71 | 7 | 75 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-22 | 3 | 71 | 7 | 75 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LPERR09G00210.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015697528.1 | 3e-28 | PREDICTED: LOB domain-containing protein 12-like | ||||
Swissprot | Q9SHE9 | 6e-23 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | A0A0D9XB57 | 4e-58 | A0A0D9XB57_9ORYZ; Uncharacterized protein | ||||
STRING | LPERR09G00210.1 | 6e-59 | (Leersia perrieri) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 8e-26 | LOB domain-containing protein 4 |