PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G13830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 204aa    MW: 22244 Da    PI: 5.7611
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G13830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.62.2e-111859648
                     HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     teEde l ++v+++   +W+ Ia+ ++ +R +k+c++ w ++l
  LPERR08G13830.1 18 TEEDEALRRGVREHRRQNWAEIAAALP-RRGPKSCRLQWCQHL 59
                     589************************.***********9986 PP

2Myb_DNA-binding49.11.3e-1567110247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T+ Ed l+v   +++G++ W+tIar+++ gR+++ +k+rw++ 
  LPERR08G13830.1  67 APFTPVEDALIVAQQRLHGNK-WATIARCLP-GRSDNAVKNRWNST 110
                      68*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.463959IPR017930Myb domain
SMARTSM007177.5E-111361IPR001005SANT/Myb domain
SuperFamilySSF466891.57E-2413107IPR009057Homeodomain-like
PfamPF002491.3E-101659IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-161673IPR009057Homeodomain-like
CDDcd001675.63E-111659No hitNo description
PROSITE profilePS5129418.47460115IPR017930Myb domain
SMARTSM007172.8E-1365113IPR001005SANT/Myb domain
PfamPF002492.7E-1267110IPR001005SANT/Myb domain
CDDcd001676.74E-1068111No hitNo description
Gene3DG3DSA:1.10.10.602.1E-1774112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MAADGDSGGG GGKKTPWTEE DEALRRGVRE HRRQNWAEIA AALPRRGPKS CRLQWCQHLS  60
PELDTRAPFT PVEDALIVAQ QRLHGNKWAT IARCLPGRSD NAVKNRWNST LRKLRRHGAV  120
RATEEDAAAA AAAQEDDTVM VCRELFPVRA GGVKEAAAAV ARLLAGEKED EEEDVEATGL  180
TLGLPVLSEA ELELRLGLAW PENA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A9e-25141132101MYB3
3zqc_D9e-25141132101MYB3
3zqc_G9e-25141132101MYB3
3zqc_J9e-25141132101MYB3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR08G13830.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126169e-95CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649306.13e-82transcription factor MYB77
SwissprotQ9SN122e-32MYB77_ARATH; Transcription factor MYB77
TrEMBLA0A0D9X8H51e-143A0A0D9X8H5_9ORYZ; Uncharacterized protein
STRINGLPERR08G13830.11e-143(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-33myb domain protein 77
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]