PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LPERR08G13830.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 204aa MW: 22244 Da PI: 5.7611 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 35.6 | 2.2e-11 | 18 | 59 | 6 | 48 |
HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 teEde l ++v+++ +W+ Ia+ ++ +R +k+c++ w ++l LPERR08G13830.1 18 TEEDEALRRGVREHRRQNWAEIAAALP-RRGPKSCRLQWCQHL 59 589************************.***********9986 PP | |||||||
2 | Myb_DNA-binding | 49.1 | 1.3e-15 | 67 | 110 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+ Ed l+v +++G++ W+tIar+++ gR+++ +k+rw++ LPERR08G13830.1 67 APFTPVEDALIVAQQRLHGNK-WATIARCLP-GRSDNAVKNRWNST 110 68*******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.463 | 9 | 59 | IPR017930 | Myb domain |
SMART | SM00717 | 7.5E-11 | 13 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.57E-24 | 13 | 107 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.3E-10 | 16 | 59 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.5E-16 | 16 | 73 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.63E-11 | 16 | 59 | No hit | No description |
PROSITE profile | PS51294 | 18.474 | 60 | 115 | IPR017930 | Myb domain |
SMART | SM00717 | 2.8E-13 | 65 | 113 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-12 | 67 | 110 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.74E-10 | 68 | 111 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.1E-17 | 74 | 112 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MAADGDSGGG GGKKTPWTEE DEALRRGVRE HRRQNWAEIA AALPRRGPKS CRLQWCQHLS 60 PELDTRAPFT PVEDALIVAQ QRLHGNKWAT IARCLPGRSD NAVKNRWNST LRKLRRHGAV 120 RATEEDAAAA AAAQEDDTVM VCRELFPVRA GGVKEAAAAV ARLLAGEKED EEEDVEATGL 180 TLGLPVLSEA ELELRLGLAW PENA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3zqc_A | 9e-25 | 14 | 113 | 2 | 101 | MYB3 |
3zqc_D | 9e-25 | 14 | 113 | 2 | 101 | MYB3 |
3zqc_G | 9e-25 | 14 | 113 | 2 | 101 | MYB3 |
3zqc_J | 9e-25 | 14 | 113 | 2 | 101 | MYB3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LPERR08G13830.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012616 | 9e-95 | CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015649306.1 | 3e-82 | transcription factor MYB77 | ||||
Swissprot | Q9SN12 | 2e-32 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A0D9X8H5 | 1e-143 | A0A0D9X8H5_9ORYZ; Uncharacterized protein | ||||
STRING | LPERR08G13830.1 | 1e-143 | (Leersia perrieri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4960 | 34 | 65 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 2e-33 | myb domain protein 77 |
Publications ? help Back to Top | |||
---|---|---|---|
|