PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G13170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family NAC
Protein Properties Length: 381aa    MW: 42748.4 Da    PI: 8.2696
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G13170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.7e-52161431128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      l pGfrFhPtdeelv++yLk+k+++k++++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t++g+Wkatg+d++++s
  LPERR08G13170.1  16 LLPGFRFHPTDEELVSFYLKRKIQQKPISI-ELIRQLDIYKFDPWDLPKLASTGEKEWYFYCPRDRKYRNSVRPNRVTAAGFWKATGTDRPIYS 108
                      579***************************.89***************9888999*************************************** PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +++ +glkk+Lvfykgra +g ktdW+mhe+rl
  LPERR08G13170.1 109 TeGTKCIGLKKSLVFYKGRAARGIKTDWMMHEFRL 143
                      956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-5813174IPR003441NAC domain
PROSITE profilePS5100556.86616174IPR003441NAC domain
PfamPF023657.9E-2618143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MEERNDINMD KSDEVLLPGF RFHPTDEELV SFYLKRKIQQ KPISIELIRQ LDIYKFDPWD  60
LPKLASTGEK EWYFYCPRDR KYRNSVRPNR VTAAGFWKAT GTDRPIYSTE GTKCIGLKKS  120
LVFYKGRAAR GIKTDWMMHE FRLPTLTDPS LPKKLIEKNI PLNDSWTICR IFKKTSSMAQ  180
RALCQAWGPH LPGAIDPDIF STLQSVQASQ LALESSSCSL QAAAPAAQIT SKYALQGNQQ  240
QQQHKPSNPQ DGSSCKVINF NCSQPADVQI GQIILPFETQ TSQKTAGAAP LLFDAQFGQP  300
DQIGRFVVDS SVNVNGGSIS NKNQDSAARK PGNGFSMNSE WEGVGRINFP FDLGADSLDD  360
WRSNIPWESF LSPTVHAEIP H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-541617717168NO APICAL MERISTEM PROTEIN
1ut4_B9e-541617717168NO APICAL MERISTEM PROTEIN
1ut7_A9e-541617717168NO APICAL MERISTEM PROTEIN
1ut7_B9e-541617717168NO APICAL MERISTEM PROTEIN
3swm_A1e-531617720171NAC domain-containing protein 19
3swm_B1e-531617720171NAC domain-containing protein 19
3swm_C1e-531617720171NAC domain-containing protein 19
3swm_D1e-531617720171NAC domain-containing protein 19
3swp_A1e-531617720171NAC domain-containing protein 19
3swp_B1e-531617720171NAC domain-containing protein 19
3swp_C1e-531617720171NAC domain-containing protein 19
3swp_D1e-531617720171NAC domain-containing protein 19
4dul_A9e-541617717168NAC domain-containing protein 19
4dul_B9e-541617717168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR08G13170.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0730130.0AK073013.1 Oryza sativa Japonica Group cDNA clone:J033000B16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006659439.10.0PREDICTED: protein FEZ-like
SwissprotQ9ZVH04e-97FEZ_ARATH; Protein FEZ
TrEMBLA0A0D9X8820.0A0A0D9X882_9ORYZ; Uncharacterized protein
STRINGLPERR08G13170.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.15e-99NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]