PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

LPERR02G05810.1

Organism

Leersia perrieri

Taxonomic ID

77586

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia

Family

MYB

Protein Properties

Length: 295aa MW: 31981.9 Da PI: 8.865

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
LPERR02G05810.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.8	6.1e-19	9	54	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + LPERR02G05810.1 9 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 54 79****************************.*********985 PP
2	Myb_DNA-binding	54.3	3e-17	61	104	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++++eEd +++a+++lG++ W++Iar ++ gRt++ +k++w++ LPERR02G05810.1 61 RRPFSPEEDAAILRAHARLGNR-WAAIARLLP-GRTDNAVKNHWNS 104 679*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.958	1	59	IPR017930	Myb domain
SuperFamily	SSF46689	1.76E-31	6	102	IPR009057	Homeodomain-like
SMART	SM00717	9.6E-17	8	57	IPR001005	SANT/Myb domain
Pfam	PF00249	3.7E-18	9	54	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.1E-25	10	62	IPR009057	Homeodomain-like
CDD	cd00167	1.25E-15	11	53	No hit	No description
SMART	SM00717	5.4E-16	60	108	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	21.408	61	110	IPR017930	Myb domain
Pfam	PF00249	2.7E-15	61	104	IPR001005	SANT/Myb domain
CDD	cd00167	2.81E-12	63	106	No hit	No description
Gene3D	G3DSA:1.10.10.60	4.6E-24	63	110	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 295 aa Download sequence Send to blast
MEAECDRIKG PWSPEEDEAL RRLVERHGAR NWTAIGRGIP GRSGKSCRLR WCNQLSPQVE 60 RRPFSPEEDA AILRAHARLG NRWAAIARLL PGRTDNAVKN HWNSSLKRKL ATATATTAAE 120 VGEIERPCKR ASPGSPTGSE RSDLSHGGCG QAVVFRPVPR PGGFDSITAT AAAAPPPRRR 180 EDDDEESLTS LSLSLSLPGQ QQEQGFRHDS ARSHFQELSP SRSPSPPSPT MIPSSYPFNA 240 EVVSAMQEMI RAEVRNYMAG VGLRAGCGAD AAAESFIVEG VMRAAAERVG VVSRQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	6e-41	6	112	4	110	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00653	PBM	Transfer from LOC_Os02g09480	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	LPERR02G05810.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP003990	1e-130	AP003990.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1073_F05.
GenBank	AP004046	1e-130	AP004046.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1145_F01.
GenBank	AP014958	1e-130	AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002451692.1	1e-137	transcription factor MYB44
Swissprot	Q9FDW1	8e-72	MYB44_ARATH; Transcription factor MYB44
TrEMBL	A0A0D9VD46	0.0	A0A0D9VD46_9ORYZ; Uncharacterized protein
STRING	LPERR02G05810.1	0.0	(Leersia perrieri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP789	38	154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G67300.1	9e-66	myb domain protein r1

Publications ? help Back to Top
Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]