PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G32790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family NAC
Protein Properties Length: 256aa    MW: 28374.4 Da    PI: 5.0153
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G32790.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM143.31.4e-4491412128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.......kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                      +pGfrF Pt+eel+++yL++k+++ + ++e+vi+ +d+y+v+Pw+L +          +ee+ w++F++r++k+a+g r++r+t sgyWka g+
  LPERR01G32790.1   9 APGFRFYPTEEELICFYLRNKLDSLRDDIERVIPVFDVYSVDPWQLSEihgilcaGGGEEEEPWFYFCPRQEKEARGGRPSRTTPSGYWKAAGT 102
                      59***************************99***************855677743223366699****************************** PP

              NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +v+s +++ +g+kkt+vfy+grap+g+kt+W m+eyr+
  LPERR01G32790.1 103 PGAVYS-DRRPIGMKKTMVFYRGRAPSGTKTNWKMNEYRA 141
                      ******.999****************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-496182IPR003441NAC domain
PROSITE profilePS5100546.1898182IPR003441NAC domain
PfamPF023653.4E-2410140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MADGGHHRAP GFRFYPTEEE LICFYLRNKL DSLRDDIERV IPVFDVYSVD PWQLSEIHGI  60
LCAGGGEEEE PWFYFCPRQE KEARGGRPSR TTPSGYWKAA GTPGAVYSDR RPIGMKKTMV  120
FYRGRAPSGT KTNWKMNEYR AFHYADAAST GAGASSSSGA AAQPSLPPQL RSEFSLCRLY  180
TKSGCQRQFD RRPLAGCHDE NPGPSTAAAA VSPEENDGSD NSMQQQQQEL IDQGGAIDPD  240
WDDVATLTAF LYWPGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-301014319144NO APICAL MERISTEM PROTEIN
1ut4_B1e-301014319144NO APICAL MERISTEM PROTEIN
1ut7_A1e-301014319144NO APICAL MERISTEM PROTEIN
1ut7_B1e-301014319144NO APICAL MERISTEM PROTEIN
3swm_A2e-301014322147NAC domain-containing protein 19
3swm_B2e-301014322147NAC domain-containing protein 19
3swm_C2e-301014322147NAC domain-containing protein 19
3swm_D2e-301014322147NAC domain-containing protein 19
3swp_A2e-301014322147NAC domain-containing protein 19
3swp_B2e-301014322147NAC domain-containing protein 19
3swp_C2e-301014322147NAC domain-containing protein 19
3swp_D2e-301014322147NAC domain-containing protein 19
4dul_A1e-301014319144NAC domain-containing protein 19
4dul_B1e-301014319144NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR01G32790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632691.11e-133NAC domain-containing protein 90 isoform X2
SwissprotQ9FMR36e-66NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A0D9V8400.0A0A0D9V840_9ORYZ; Uncharacterized protein
STRINGLPERR01G32790.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100538140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.19e-67NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]