PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LPERR01G11670.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 144aa MW: 16570.8 Da PI: 9.4594 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 31.4 | 3.2e-10 | 78 | 111 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++e++ +LA+++gL+ +q+ +WF N+R ++ LPERR01G11670.2 78 WPYPTEEDKLRLAARTGLDPKQINNWFINQRKRH 111 69*****************************985 PP | |||||||
2 | ELK | 34.6 | 4.3e-12 | 31 | 52 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++Ll+KYsg+L+ L++EF+ LPERR01G11670.2 31 ELKEMLLKKYSGCLSRLRSEFL 52 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03789 | 5.0E-9 | 31 | 52 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 10.423 | 31 | 51 | IPR005539 | ELK domain |
SMART | SM01188 | 3.6E-6 | 31 | 52 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.843 | 51 | 114 | IPR001356 | Homeobox domain |
SMART | SM00389 | 6.6E-14 | 53 | 118 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 5.56E-20 | 53 | 120 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.8E-27 | 56 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 4.63E-13 | 63 | 115 | No hit | No description |
Pfam | PF05920 | 1.9E-17 | 71 | 110 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 89 | 112 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010073 | Biological Process | meristem maintenance | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MMGSSDEDQC SGETDMLDIG QEQSSRLADH ELKEMLLKKY SGCLSRLRSE FLKKRKKGKL 60 PKDARSALLE WWNTHYRWPY PTEEDKLRLA ARTGLDPKQI NNWFINQRKR HWKPSEGMRF 120 ALMEGVAGGS SGTTLYFDTG TIGP |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 46 | 55 | LRSEFLKKRK |
2 | 52 | 56 | KKRKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during early embryogenesis. {ECO:0000269|PubMed:10488233}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00670 | PBM | Transfer from GRMZM2G087741 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LPERR01G11670.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK241312 | 1e-164 | AK241312.1 Oryza sativa Japonica Group cDNA, clone: J065141L09, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006644109.1 | 1e-103 | PREDICTED: homeobox protein knotted-1-like 1 | ||||
Swissprot | Q9FP29 | 1e-104 | KNOS1_ORYSJ; Homeobox protein knotted-1-like 1 | ||||
TrEMBL | A0A0D9V034 | 1e-103 | A0A0D9V034_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0D9V035 | 1e-103 | A0A0D9V035_9ORYZ; Uncharacterized protein | ||||
STRING | LPERR01G11670.1 | 1e-103 | (Leersia perrieri) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G08150.1 | 8e-42 | KNOTTED-like from Arabidopsis thaliana |
Publications ? help Back to Top | |||
---|---|---|---|
|