PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G00270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family NAC
Protein Properties Length: 312aa    MW: 34693.6 Da    PI: 6.6338
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G00270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.66.8e-55141421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtdee++++yL++kv +++ +++  +i evd++k+ePw+Lp k+   +ekewyf++++d+ky+tg r+nrat++gyWkatgkdke+
  LPERR01G00270.1  14 LPPGFRFHPTDEEIITFYLTPKVLDSRgFSV-IAIGEVDLNKSEPWELPgKAKMIGEKEWYFYCQKDRKYPTGMRTNRATEAGYWKATGKDKEI 106
                      79********************999995666.88***************544445899************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++++ lvg+kktLvfykgrapkg kt+Wvmheyrl
  LPERR01G00270.1 107 FRHNHLLVGMKKTLVFYKGRAPKGDKTNWVMHEYRL 142
                      **9999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-6010181IPR003441NAC domain
PROSITE profilePS5100558.19814181IPR003441NAC domain
PfamPF023652.3E-2815142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGEQQQQAER QPDLPPGFRF HPTDEEIITF YLTPKVLDSR GFSVIAIGEV DLNKSEPWEL  60
PGKAKMIGEK EWYFYCQKDR KYPTGMRTNR ATEAGYWKAT GKDKEIFRHN HLLVGMKKTL  120
VFYKGRAPKG DKTNWVMHEY RLADGHPAAA AATEPVVVNN SSNNPPMPRH DDWAVCRIFH  180
KSSGIKKPVQ MPVQAPPTTY QQQMNMVAAG IVPVPMQMVP DMQQAMDDFS GGVALQQMNP  240
LMASSSYSTL PAFPGAATGL PMMNPPPPMP QFYQQMEMGG GFMVDDPASG PSSQDAENAG  300
DLSGMDAAMW KY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-5211877174NAC domain-containing protein 19
3swm_B5e-5211877174NAC domain-containing protein 19
3swm_C5e-5211877174NAC domain-containing protein 19
3swm_D5e-5211877174NAC domain-containing protein 19
3swp_A5e-5211877174NAC domain-containing protein 19
3swp_B5e-5211877174NAC domain-containing protein 19
3swp_C5e-5211877174NAC domain-containing protein 19
3swp_D5e-5211877174NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR01G00270.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006645428.11e-132PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLR36e-79NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A0D9UVT20.0A0A0D9UVT2_9ORYZ; Uncharacterized protein
STRINGLPERR01G00270.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.21e-78Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  4. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]