PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v1559270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family CAMTA
Protein Properties Length: 907aa    MW: 102956 Da    PI: 7.5181
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v1559270.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1158.81.1e-49311463118
             CG-1   3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqr 96 
                      + k+rwl+++ei++iL n++ +++  ++ + pksg+++L++rk++r+frkDG++wkkkkdgktv+E+he+LKvg+ e +++yYah+++np+f r
  Lj6g3v1559270.1  31 EAKSRWLRPNEIHSILCNHKYFTIYVKPVRLPKSGTIVLFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGQDNPSFVR 124
                      459******************************************************************************************* PP

             CG-1  97 rcywlLeeelekivlvhylevk 118
                      rcywlL++ le+ivl hy+e++
  Lj6g3v1559270.1 125 RCYWLLDKILEHIVLFHYRETQ 146
                      *******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143775.81525151IPR005559CG-1 DNA-binding domain
SMARTSM010765.0E-7228146IPR005559CG-1 DNA-binding domain
PfamPF038597.1E-4431144IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.107.7E-5335440IPR013783Immunoglobulin-like fold
SuperFamilySSF812961.87E-15351438IPR014756Immunoglobulin E-set
PfamPF018332.9E-4352437IPR002909IPT domain
CDDcd002044.55E-15528647No hitNo description
PfamPF127964.1E-7529617IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.7E-15546650IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.87E-17547650IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029715.3555620IPR020683Ankyrin repeat-containing domain
SMARTSM002482.0E-5588617IPR002110Ankyrin repeat
PROSITE profilePS5008811.194588620IPR002110Ankyrin repeat
SMARTSM002482100627658IPR002110Ankyrin repeat
SMARTSM0001528752774IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500966.852753779IPR000048IQ motif, EF-hand binding site
PfamPF006120.18755773IPR000048IQ motif, EF-hand binding site
SMARTSM000150.17775797IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.883776800IPR000048IQ motif, EF-hand binding site
PfamPF006120.014777797IPR000048IQ motif, EF-hand binding site
SMARTSM0001519855877IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.876857885IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 907 aa     Download sequence    Send to blast
MAHTLTGQLV GSEIHGFHTL QDLDVENTLE EAKSRWLRPN EIHSILCNHK YFTIYVKPVR  60
LPKSGTIVLF DRKMLRNFRK DGHNWKKKKD GKTVKEAHEH LKVGNEERIH VYYAHGQDNP  120
SFVRRCYWLL DKILEHIVLF HYRETQESQG SPATPVNSTS SSASGPTGPL ILSEDLDSGT  180
NNAYTEGLND NLTTESHDLR LHEINTLEWD DLLVPNANTS NVPNGGNELY LYQQNQTSPN  240
DSFGNVASNP SAEIPSFGNL TQPISGSNNV PYNFPESVNL QSNCPISSGG VGSIGTVVDE  300
GLQKQDSFGT WINNIISDTP CSVDGSALVS SISSSVVVDN QPSYLPEQVF NLTEVSPTWA  360
SSTEKTKVLV TGFFHNDYQH LTKSNLLCVC GDVSVPLEFV QVGVYRCWVS PHSPGFVNLY  420
MSLDSQKPIS QVVNFEYRTP ILHDPASSME QKYNWNEFRL QTRLAHLLFT TKRRLDAFSS  480
KVSPNALKEA RKFADKTSFV TKYWQNLMKS VDDNTAPFPQ AKDDLFEIAL KNKLKEWLLE  540
RIVLGCCKTT EYDSQGQGVI HLCAVLGYTW AVSLFSWSGL SLDFRDKFGW TALHWAAYYG  600
MEKMVAVLLS YGARPNLVTD PTPQNPGGCT AADLAYMKGY DGLAAYLSEK SLVEQFNDMS  660
LAGNISGSLE TTSTTDPVNP ENLTEDQLYI KDTLAAYRTA AEAAARIQVA FRHRSLKLRS  720
QAVEFLSPEE EARQIVAAMK IQHAFRNFET RKMMAAAARI QYRFRTWKMR KDFLLMRRQA  780
IRIQSAFRAF QARRQYHKIM WSVGVLEKAI LRWRLKRKGF RGLQVNLDEE MKDEKQESDV  840
EEEFFRTGRK QAEERVERSV VRVQAMFRSK KAQKEYSRMK MAHSQVKLEL ELEEFLNSEV  900
DMSSSKI
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, pollen, top of sepals and siliques. {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:14581622}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:14581622). Binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in response to cold. Contributes together with CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:14581622, ECO:0000269|PubMed:28351986, ECO:0000305|PubMed:11925432}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00435DAPTransfer from AT4G16150Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj6g3v1559270.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat shock, UVB, wounding, abscisic acid, H(2)O(2) and salicylic acid. {ECO:0000269|PubMed:12218065}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1267781e-126AC126778.9 Medicago truncatula clone mth2-32j21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027339147.10.0calmodulin-binding transcription activator 5-like isoform X2
RefseqXP_027339148.10.0calmodulin-binding transcription activator 5-like isoform X2
SwissprotO234630.0CMTA5_ARATH; Calmodulin-binding transcription activator 5
TrEMBLA0A396JD540.0A0A396JD54_MEDTR; Putative transcription factor CG1-CAMTA family
TrEMBLG7IMU60.0G7IMU6_MEDTR; Calmodulin-binding transcription activator
STRINGAES650410.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42883459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16150.10.0calmodulin binding;transcription regulators
Publications ? help Back to Top
  1. Ye J, et al.
    Arabidopsis formin3 directs the formation of actin cables and polarized growth in pollen tubes.
    Plant Cell, 2009. 21(12): p. 3868-84
    [PMID:20023198]
  2. Kidokoro S, et al.
    Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.
    Plant Cell, 2017. 29(4): p. 760-774
    [PMID:28351986]
  3. Lan Y,Liu X,Fu Y,Huang S
    Arabidopsis class I formins control membrane-originated actin polymerization at pollen tube tips.
    PLoS Genet., 2018. 14(11): p. e1007789
    [PMID:30418966]