PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj5g3v1412990.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 212aa MW: 23255.1 Da PI: 10.5663 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 52.4 | 1.2e-16 | 5 | 56 | 3 | 54 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 + kr rr+ +NRe+ArrsR+RK+a + Le+ v +L++eN++L k+ + ++ Lj5g3v1412990.1 5 DAKRVRRMLSNRESARRSRRRKQAHLTDLETQVSQLKGENSSLLKRFSDVSQ 56 689****************************************999877666 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.0E-19 | 3 | 67 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 6.3E-14 | 4 | 58 | No hit | No description |
PROSITE profile | PS50217 | 11.381 | 5 | 59 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 3.0E-15 | 6 | 54 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.21E-12 | 7 | 56 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 10 | 25 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF12498 | 1.5E-44 | 74 | 201 | IPR020983 | Basic leucine-zipper, C-terminal |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0071215 | Biological Process | cellular response to abscisic acid stimulus | ||||
GO:0071333 | Biological Process | cellular response to glucose stimulus | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042802 | Molecular Function | identical protein binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 212 aa Download sequence Send to blast |
MDPSDAKRVR RMLSNRESAR RSRRRKQAHL TDLETQVSQL KGENSSLLKR FSDVSQKFND 60 SAVDNRVLKA DVETLRAKVK MAEETVKRIT GLNPMFHAMS EISSMGMPPF AGSPSDNSVD 120 AAVPVQDNSH HQQFYRPVSN NPMPRHDLRV NNGLGDISSI ENVQQQNGAA VAGGNKMGQA 180 AAPLQRVASL EHLQKRIRGG VDSCGAPSNG EQ |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 19 | 26 | RRSRRRKQ |
2 | 21 | 26 | SRRRKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.279 | 1e-155 | cell culture| floral bud| pod| root |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00040 | PBM | Transfer from AT5G28770 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj5g3v1412990.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP009810 | 0.0 | AP009810.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT29J15, TM0280b, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004495799.1 | 1e-112 | light-inducible protein CPRF2-like isoform X1 | ||||
Refseq | XP_004495800.1 | 1e-113 | light-inducible protein CPRF2-like isoform X2 | ||||
Swissprot | Q99090 | 5e-81 | CPRF2_PETCR; Light-inducible protein CPRF2 | ||||
TrEMBL | A0A1S2XWX9 | 1e-111 | A0A1S2XWX9_CICAR; light-inducible protein CPRF2-like isoform X1 | ||||
TrEMBL | A0A1S2XY94 | 1e-111 | A0A1S2XY94_CICAR; light-inducible protein CPRF2-like isoform X2 | ||||
STRING | XP_004495799.1 | 1e-112 | (Cicer arietinum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G28770.1 | 1e-45 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|