PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj4g3v2628690.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 247aa MW: 28136.7 Da PI: 10.2964 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.9 | 2e-31 | 26 | 75 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyey+ Lj4g3v2628690.1 26 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYA 75 79***********************************************8 PP | |||||||
2 | K-box | 109.6 | 3.5e-36 | 96 | 190 | 6 | 100 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 g s++ a+a+ +qqe+akL+ +i+nLq+ +R++lGe L++++ ++L++Le++Lek++++iRskKne+l+++ie++qk+e +l++ n+ Lr+k++ Lj4g3v2628690.1 96 GGSTSGANAQFYQQEAAKLRVQISNLQNHNRQMLGEALSNMNARDLKNLETKLEKGISRIRSKKNEMLFAEIEYMQKREIDLHNSNQLLRAKIA 189 44578899************************************************************************************98 PP K-box 100 e 100 e Lj4g3v2628690.1 190 E 190 6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 34.076 | 18 | 78 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.3E-42 | 18 | 77 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.44E-32 | 19 | 90 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.00E-43 | 19 | 88 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 20 | 74 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.2E-33 | 20 | 40 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-26 | 27 | 74 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.2E-33 | 40 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.2E-33 | 55 | 76 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.1E-26 | 103 | 188 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.343 | 104 | 194 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 247 aa Download sequence Send to blast |
MSSPNQSMSA NNSPQRKMGR GKIEIKRIEN TTNRQVTFCK RRNGLLKKAY ELSVLCDAEV 60 ALIVFSNRGR LYEYANNSVK ASIERYKKAC SDSSGGGSTS GANAQFYQQE AAKLRVQISN 120 LQNHNRQMLG EALSNMNARD LKNLETKLEK GISRIRSKKN EMLFAEIEYM QKREIDLHNS 180 NQLLRAKIAE SDERKNHNFN MLPGTTNFES LQQSQQPFDS RGFFQVTGLQ PNNNQCARQD 240 QISLQFV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-20 | 18 | 86 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-20 | 18 | 86 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-20 | 18 | 86 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-20 | 18 | 86 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-20 | 18 | 86 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-20 | 18 | 86 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-20 | 18 | 86 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-20 | 18 | 86 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-20 | 18 | 86 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-20 | 18 | 86 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.11051 | 0.0 | pod |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj4g3v2628690.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY770403 | 0.0 | AY770403.1 Lotus corniculatus var. japonicus MADS box protein AGb mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017405872.1 | 1e-147 | PREDICTED: floral homeotic protein AGAMOUS-like | ||||
Refseq | XP_022638657.1 | 1e-147 | floral homeotic protein AGAMOUS-like isoform X2 | ||||
Refseq | XP_022638658.1 | 1e-147 | floral homeotic protein AGAMOUS-like isoform X2 | ||||
Swissprot | Q43585 | 1e-122 | AG_TOBAC; Floral homeotic protein AGAMOUS | ||||
TrEMBL | Q533S0 | 1e-166 | Q533S0_LOTJA; MADS box protein AGb (Fragment) | ||||
STRING | XP_004504255.1 | 1e-142 | (Cicer arietinum) | ||||
STRING | AET04353 | 1e-142 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF684 | 29 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-115 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|