PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj4g3v0216670.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 173aa MW: 20095.7 Da PI: 10.0414 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57 | 4.5e-18 | 26 | 73 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+l+ +v ++G g+W+ + + g+ R++k+c++rw ++l Lj4g3v0216670.1 26 KGPWTPEEDEILAAYVIKHGEGNWNIVQKNTGLYRCGKSCRLRWTNHL 73 79*******************************************996 PP | |||||||
2 | Myb_DNA-binding | 44.6 | 3.3e-14 | 79 | 122 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g+++++E+ v+ +++lG++ W++ a+ ++ gRt++++k++w++ Lj4g3v0216670.1 79 KGPFSKDEQRVVVEMHARLGNK-WSKMAQQLP-GRTDNEIKNFWHT 122 79********************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.933 | 21 | 77 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.7E-23 | 21 | 76 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.56E-30 | 23 | 120 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.5E-15 | 25 | 75 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-16 | 26 | 73 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.32E-11 | 28 | 73 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.5E-22 | 77 | 126 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.7E-12 | 78 | 126 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.052 | 78 | 128 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.5E-12 | 79 | 122 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.56E-8 | 81 | 122 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MSLPSSSNGK GKSTGRDNDA EEDMRKGPWT PEEDEILAAY VIKHGEGNWN IVQKNTGLYR 60 CGKSCRLRWT NHLRPNLRKG PFSKDEQRVV VEMHARLGNK WSKMAQQLPG RTDNEIKNFW 120 HTRRKKLERV KMPLYPPHLK VLHDDQGCSS RQQPNASPSQ EDEFEKPEEK FKT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-27 | 23 | 126 | 4 | 106 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Accumulates in the pollen tube nucleus during pollen tube growth through the pistil. {ECO:0000269|PubMed:23791732}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in pollen grains and pollen tube (PubMed:23791732, PubMed:24278028). Mostly expressed in mature pollen grains, and, to a lower extent, in inflorescences and siliques (PubMed:24278028). {ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB97 and MYB101, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250|UniProtKB:O80883, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj4g3v0216670.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in pollen tube 4 hours after pollen germination. {ECO:0000269|PubMed:19714218}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020238230.1 | 1e-60 | transcription factor MYB101 | ||||
Refseq | XP_022637422.1 | 1e-62 | transcription factor MYB101-like | ||||
Swissprot | Q94FL7 | 3e-59 | MY120_ARATH; Transcription factor MYB120 | ||||
TrEMBL | A0A3Q0F4T2 | 2e-61 | A0A3Q0F4T2_VIGRR; transcription factor MYB101-like | ||||
STRING | EFJ15829 | 2e-59 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G55020.1 | 2e-61 | myb domain protein 120 |
Publications ? help Back to Top | |||
---|---|---|---|
|