PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj4g3v0109410.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 164aa MW: 18254.4 Da PI: 5.7388 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 170.8 | 1.6e-53 | 21 | 116 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 re +r+lPianvsrimkk+lP+nakisk+aket+qec sefisf+t+easdkcq+ekrktingddl+wa++tlGfedyv++lk yl+kyr++eg Lj4g3v0109410.1 21 RELERLLPIANVSRIMKKALPGNAKISKEAKETMQECLSEFISFITAEASDKCQNEKRKTINGDDLVWAMTTLGFEDYVQALKGYLHKYRDMEG 114 7889****************************************************************************************** PP NF-YB 96 ek 97 ek Lj4g3v0109410.1 115 EK 116 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.6E-51 | 18 | 130 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.37E-39 | 24 | 128 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-27 | 26 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.3E-18 | 54 | 72 | No hit | No description |
PRINTS | PR00615 | 1.3E-18 | 73 | 91 | No hit | No description |
PRINTS | PR00615 | 1.3E-18 | 92 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MAESDKEIGG KNELTSPNGC RELERLLPIA NVSRIMKKAL PGNAKISKEA KETMQECLSE 60 FISFITAEAS DKCQNEKRKT INGDDLVWAM TTLGFEDYVQ ALKGYLHKYR DMEGEKTNYS 120 FIGRQQQNQQ GDDDAVGSGV SMPSSSTSYH HQGVMYASGN VWKS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-44 | 21 | 111 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-44 | 21 | 111 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj4g3v0109410.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004486346.1 | 5e-64 | nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_020230669.1 | 4e-64 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | Q75IZ7 | 4e-58 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A151SBC7 | 1e-62 | A0A151SBC7_CAJCA; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A1S2XAJ8 | 1e-62 | A0A1S2XAJ8_CICAR; nuclear transcription factor Y subunit B-3-like | ||||
STRING | XP_004486346.1 | 2e-63 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 3e-59 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|