PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj3g3v2809840.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 152aa MW: 16908.4 Da PI: 8.7697 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 77 | 2.9e-24 | 95 | 146 | 1 | 52 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEET CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhel 52 +Cq+e+C+adl +ak+yhrrhkvCe h+ka+vvlv g++qrfCqqCsrf e+ Lj3g3v2809840.1 95 CCQAEKCNADLHDAKQYHRRHKVCEYHAKAQVVLVGGTRQRFCQQCSRFGEV 146 6************************************************765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 6.5E-25 | 88 | 146 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 19.529 | 93 | 152 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.22E-22 | 94 | 145 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 8.1E-19 | 96 | 146 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MEHFVVLTSS FPFSSASFCL LLFSPHIIPL SNQLQPTIDT SLLPLHMDGS EAKAMRSDKV 60 QQVTMNDQNG YQEVDKKKKG KGSGSSGGGG SITRCCQAEK CNADLHDAKQ YHRRHKVCEY 120 HAKAQVVLVG GTRQRFCQQC SRFGEVRLLC FL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-18 | 84 | 146 | 1 | 61 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj3g3v2809840.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP007305 | 0.0 | AP007305.2 Lotus japonicus genomic DNA, chromosome 3, clone: LjT29I08, TM1257, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002275728.1 | 2e-32 | PREDICTED: squamosa promoter-binding protein 1 isoform X2 | ||||
Refseq | XP_020229499.1 | 6e-32 | squamosa promoter-binding-like protein 4 | ||||
TrEMBL | A0A438EGP2 | 4e-31 | A0A438EGP2_VITVI; Squamosa promoter-binding-like protein | ||||
TrEMBL | E0CTG4 | 4e-31 | E0CTG4_VITVI; Squamosa promoter-binding-like protein | ||||
STRING | VIT_12s0028g03350.t01 | 6e-32 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G02065.2 | 1e-21 | squamosa promoter binding protein-like 8 |