PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj3g3v2477670.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 156aa MW: 17911.6 Da PI: 10.3684 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.9 | 2e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ed ll ++++ +G g+Wk+ +++ g+ R++k+c++rw +yl Lj3g3v2477670.1 14 KGPWTPKEDALLTKYIHAHGEGQWKSLPKKAGLLRCGKSCRLRWMNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 55.3 | 1.5e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ ++eEd+l+++++ +lG++ W++Ia +++ gRt++++k++w+++l Lj3g3v2477670.1 67 RGNISPEEDDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112 7999******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.671 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.24E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.7E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.2E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.2E-25 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.02E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.807 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 7.1E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.2E-16 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.4E-27 | 69 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.06E-12 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MGRAPCCSKV GLHKGPWTPK EDALLTKYIH AHGEGQWKSL PKKAGLLRCG KSCRLRWMNY 60 LRPDIKRGNI SPEEDDLIIR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLCKKNMRLQ 120 GITTDHESNY NNEEELDPEQ KPAGSAKKKK NTKKKN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-26 | 12 | 115 | 5 | 107 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.184 | 0.0 | root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In seedlings, predominantly expressed in cotyledons. Restricted to the cotyledons and primary leaves. {ECO:0000269|PubMed:17419845}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, cotyledons and young leaves. {ECO:0000269|PubMed:17419845}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis primarily in cotyledons and leaves (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj3g3v2477670.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Triggered by HY5 in response to light and UV-B. {ECO:0000269|PubMed:19895401}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT139763 | 0.0 | BT139763.1 Lotus japonicus clone JCVI-FLLj-19I6 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027906642.1 | 2e-82 | transcription repressor MYB6-like | ||||
Swissprot | Q9FJ07 | 6e-62 | MY111_ARATH; Transcription factor MYB111 | ||||
TrEMBL | I3SH16 | 1e-111 | I3SH16_LOTJA; Uncharacterized protein | ||||
STRING | XP_007135274.1 | 1e-81 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49330.1 | 4e-64 | myb domain protein 111 |