PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj3g3v0419510.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 166aa MW: 19134.7 Da PI: 4.7003 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100.9 | 7.5e-32 | 105 | 163 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YYrC+ +gC+vkk+ver+++dp++v++tYeg+H+h+ Lj3g3v0419510.1 105 LDDGFKWRKYGKKMVKNSPNPRNYYRCSVEGCRVKKRVERDRDDPSYVITTYEGTHTHP 163 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.2E-34 | 91 | 163 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.44E-28 | 98 | 164 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.021 | 100 | 165 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.8E-37 | 105 | 164 | IPR003657 | WRKY domain |
Pfam | PF03106 | 8.5E-26 | 106 | 163 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MTDKNPVSLP PDSPESDFIN QWPQELSEYL KLDDDNQWPD DDDHPDHSFA NSWHVLNQDN 60 QTNQVGDFGG SSSNVEGSST NVNIEDEKAV KEKVSFKTKS EVEILDDGFK WRKYGKKMVK 120 NSPNPRNYYR CSVEGCRVKK RVERDRDDPS YVITTYEGTH THPSSY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 9e-25 | 95 | 162 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 9e-25 | 95 | 162 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj3g3v0419510.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP010362 | 1e-132 | AP010362.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT12P09, TM1929, complete sequence. | |||
GenBank | AP010363 | 1e-132 | AP010363.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT61C17, TM2005, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004501445.2 | 1e-66 | probable WRKY transcription factor 50 isoform X1 | ||||
Swissprot | Q8VWQ5 | 9e-43 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A2K3L8P8 | 2e-66 | A0A2K3L8P8_TRIPR; WRKY transcription factor | ||||
STRING | XP_004501445.1 | 7e-66 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1120 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 4e-34 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|