PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj2g3v0934070.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 138aa MW: 15381.4 Da PI: 7.8377 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 138.8 | 1.8e-43 | 11 | 109 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +CaaCk+lrrkC +dC+++pyfp e+p+kf nvhk+FGasnv+k+l+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el Lj2g3v0934070.1 11 PCAACKFLRRKCMSDCIFSPYFPPEEPHKFVNVHKIFGASNVSKILNEVLPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVLRLQKEL 104 7********************************************************************************************* PP DUF260 95 allke 99 +++++ Lj2g3v0934070.1 105 DAANA 109 99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.38 | 10 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.4E-43 | 11 | 108 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MASSSYSNNS PCAACKFLRR KCMSDCIFSP YFPPEEPHKF VNVHKIFGAS NVSKILNEVL 60 PHQREDAVNS LAYEAEARIK DPVYGCVGAI SVLQRQVLRL QKELDAANAD LIRYSACSET 120 PTTHHGGSGF YYPWNNHG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-63 | 2 | 119 | 2 | 118 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-63 | 2 | 119 | 2 | 118 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj2g3v0934070.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP009666 | 0.0 | AP009666.1 Lotus japonicus genomic DNA, chromosome 2, clone: LjT30P12, TM0263, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006579776.1 | 3e-81 | LOB domain-containing protein 25 | ||||
Refseq | XP_014630864.1 | 3e-81 | LOB domain-containing protein 25 | ||||
Refseq | XP_028231096.1 | 3e-81 | LOB domain-containing protein 25-like | ||||
Refseq | XP_028231097.1 | 3e-81 | LOB domain-containing protein 25-like | ||||
Swissprot | Q9FML4 | 5e-69 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A445KHB7 | 7e-80 | A0A445KHB7_GLYSO; LOB domain-containing protein 25 isoform A | ||||
TrEMBL | K7KNN7 | 7e-80 | K7KNN7_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA05G08870.2 | 1e-80 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1091 | 34 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 2e-71 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|