PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj1g3v4241070.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 85aa MW: 9652.99 Da PI: 4.4456 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 82.6 | 5.6e-26 | 26 | 85 | 2 | 61 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 Fl k+y ++ed++++e+isw+++g++fvv+++ efa+++Lp+ Fkhsnf+SFvRQLn+Yg Lj1g3v4241070.1 26 FLLKTYMLVEDPTTDEVISWNDEGTAFVVWQPAEFARDLLPTLFKHSNFSSFVRQLNTYG 85 9**********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 2.5E-27 | 19 | 85 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 1.2E-18 | 22 | 85 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 4.52E-24 | 24 | 85 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 8.2E-22 | 26 | 85 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 6.9E-17 | 26 | 49 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 6.9E-17 | 64 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 6.9E-17 | 77 | 85 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MDQGVVSDNK GLLLECGIRK CNPPPFLLKT YMLVEDPTTD EVISWNDEGT AFVVWQPAEF 60 ARDLLPTLFK HSNFSSFVRQ LNTYG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ldu_A | 1e-17 | 22 | 85 | 16 | 79 | Heat shock factor protein 1 |
5d5u_B | 1e-17 | 22 | 85 | 25 | 88 | Heat shock factor protein 1 |
5d5v_B | 1e-17 | 22 | 85 | 25 | 88 | Heat shock factor protein 1 |
5d5v_D | 1e-17 | 22 | 85 | 25 | 88 | Heat shock factor protein 1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.5507 | 1e-141 | floral bud| root |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj1g3v4241070.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004493479.1 | 2e-46 | LOW QUALITY PROTEIN: heat stress transcription factor B-3 | ||||
Swissprot | Q7XRX3 | 4e-35 | HFB2A_ORYSJ; Heat stress transcription factor B-2a | ||||
TrEMBL | A0A1S2XRP2 | 5e-45 | A0A1S2XRP2_CICAR; LOW QUALITY PROTEIN: heat stress transcription factor B-3 | ||||
STRING | XP_004493479.1 | 8e-46 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1592 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G41690.1 | 3e-37 | heat shock transcription factor B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|