PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj1g3v4048460.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 163aa MW: 18449.9 Da PI: 10.6128 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 51.2 | 2.6e-16 | 93 | 136 | 5 | 48 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 +r++r++kNRe+A rsR+RK+a+++eLe kv Le+eN++L+ + Lj1g3v4048460.1 93 RRQKRMIKNRESAARSRARKQAYTQELEIKVSRLEEENERLRRQ 136 79***************************************954 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.3E-15 | 86 | 136 | No hit | No description |
SMART | SM00338 | 1.5E-13 | 89 | 157 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.588 | 91 | 136 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.19E-12 | 93 | 139 | No hit | No description |
Pfam | PF00170 | 1.5E-13 | 93 | 136 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 1.72E-22 | 93 | 138 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 96 | 111 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MQYQLPSVQQ QQPPQQQHQN PQNNMMTGFA GYMAGHVVQQ PLAVAVNPVL DAGYSEAMVT 60 VSPSSLMGTL SESQTPSRKR VASGIVVEKT VERRQKRMIK NRESAARSRA RKQAYTQELE 120 IKVSRLEEEN ERLRRQHEIE QVLPSVPPPD PKHQLRRTSS SPL |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}. | |||||
Uniprot | TISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj1g3v4048460.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003624832.1 | 2e-78 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Swissprot | Q9LES3 | 9e-55 | AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
TrEMBL | Q2HUH2 | 3e-77 | Q2HUH2_MEDTR; BZIP transcription factor | ||||
STRING | AES81050 | 6e-78 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1320 | 34 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56850.1 | 8e-48 | ABA-responsive element binding protein 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|