PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lj1g3v2416620.1

Organism

Lotus japonicus

Taxonomic ID

34305

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

WRKY

Protein Properties

Length: 265aa MW: 29359 Da PI: 8.8008

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj1g3v2416620.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	24	7.8e-08	2	26	35	60
EEEEEE-SSSTTEEEEEEES--SS-- CS WRKY 35 kkkversaedpkvveitYegeHnhek 60 +kkvers d++++ei+Y+g+Hnh+k Lj1g3v2416620.1 2 RKKVERSL-DGEITEIVYKGSHNHPK 26 8*****.*************85 PP
2	WRKY	101.9	3.8e-32	123	181	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vkg++++rsYY+Ct +gC+v+k+ver+a+d k v++tYeg+Hnh+ Lj1g3v2416620.1 123 LDDGYRWRKYGQKVVKGNPNARSYYKCTAQGCSVRKHVERAAHDIKSVITTYEGKHNHD 181 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.6E-4	2	27	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	3.6E-36	108	183	IPR003657	WRKY domain
SuperFamily	SSF118290	2.62E-28	115	183	IPR003657	WRKY domain
PROSITE profile	PS50811	37.195	118	183	IPR003657	WRKY domain
SMART	SM00774	7.4E-36	123	182	IPR003657	WRKY domain
Pfam	PF03106	1.8E-24	124	181	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 265 aa Download sequence Send to blast
MRKKVERSLD GEITEIVYKG SHNHPKPQST RRTSSQQFHQ PSSSCTNSVI SDIQEDSSAS 60 VGEEDFAAQT SQTSYSGGND DDFGPEAKRW KGDNENDSYS ASESRTVKEP RVVVQTRSEI 120 DILDDGYRWR KYGQKVVKGN PNARSYYKCT AQGCSVRKHV ERAAHDIKSV ITTYEGKHNH 180 DVPAARGSAG YNMNRNSLNS TVSAPIKPSV VSCYNNSASS FTNSVYKTKL PENGNQESYP 240 QNILQSPGSF GRDSSFLQSF LSKGF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	5e-38	114	184	8	78	Probable WRKY transcription factor 4
2lex_A	5e-38	114	184	8	78	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Lja.17904	0.0	root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in roots, leaves and flowers, and at lower levels in stems, siliques and seeds. {ECO:0000269\|PubMed:18839316}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-TTGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Involved in defense responses. Required for resistance to the necrotrophic fungal pathogen B.cinerea (PubMed:17059405, PubMed:21990940). Regulates the antagonistic relationship between defense pathways mediating responses to the bacterial pathogen P. syringae and the necrotrophic pathogen B.cinerea (PubMed:17059405). Required for the phytoalexin camalexin synthesis following infection with B.cinerea. Acts as positive regulator of the camalexin biosynthetic genes PAD3 (CYP71B15) and CYP71A13 by binding to their promoters (PubMed:21498677, PubMed:22392279). Acts downstream of MPK3 and MPK6 in reprogramming the expression of camalexin biosynthetic genes, which drives the metabolic flow to camalexin production (PubMed:21498677). Functions with WRKY25 as positive regulator of salt stress response and abscisic acid (ABA) signaling (PubMed:18839316). Functions with WRKY25 and WRKY26 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). The DNA-binding activity of WRKY33 is increased by SIB1 and SIB2 (PubMed:21990940). {ECO:0000269\|PubMed:18839316, ECO:0000269\|PubMed:21336597, ECO:0000269\|PubMed:21498677, ECO:0000269\|PubMed:21990940, ECO:0000269\|PubMed:22392279}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj1g3v2416620.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt stress (PubMed:18839316). Induced by infection with the necrotrophic fungal pathogen B.cinerea (PubMed:17059405, PubMed:21498677, PubMed:21990940). Induced by infection with the bacterial pathogen P.syringae pv. tomato DC3000 (PubMed:17059405). {ECO:0000269\|PubMed:17059405, ECO:0000269\|PubMed:18839316, ECO:0000269\|PubMed:21498677, ECO:0000269\|PubMed:21990940}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT147435	0.0	BT147435.1 Lotus japonicus clone JCVI-FLLj-21E6 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027352740.1	1e-149	probable WRKY transcription factor 33 isoform X1
Refseq	XP_027352741.1	1e-149	probable WRKY transcription factor 33 isoform X2
Swissprot	Q8S8P5	2e-78	WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBL	I3T3Y7	0.0	I3T3Y7_LOTJA; Uncharacterized protein
STRING	XP_007140176.1	1e-143	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1077	34	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G38470.1	8e-81	WRKY DNA-binding protein 33

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Brand LH, et al. Screening for protein-DNA interactions by automatable DNA-protein interaction ELISA. PLoS ONE, 2013. 8(10): p. e75177 [PMID:24146751] Ali MA,Wieczorek K,Kreil DP,Bohlmann H The beet cyst nematode Heterodera schachtii modulates the expression of WRKY transcription factors in syncytia to favour its development in Arabidopsis roots. PLoS ONE, 2014. 9(7): p. e102360 [PMID:25033038] Divi UK,Rahman T,Krishna P Gene expression and functional analyses in brassinosteroid-mediated stress tolerance. Plant Biotechnol. J., 2016. 14(1): p. 419-32 [PMID:25973891] Peskan-Berghöfer T, et al. Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots. New Phytol., 2015. 208(3): p. 873-86 [PMID:26075497] Wang C, et al. The Arabidopsis Mediator Complex Subunit16 Is a Key Component of Basal Resistance against the Necrotrophic Fungal Pathogen Sclerotinia sclerotiorum. Plant Physiol., 2015. 169(1): p. 856-72 [PMID:26143252] Wang C, et al. Arabidopsis Elongator subunit 2 positively contributes to resistance to the necrotrophic fungal pathogens Botrytis cinerea and Alternaria brassicicola. Plant J., 2015. 83(6): p. 1019-33 [PMID:26216741] Datta R, et al. Glutathione Regulates 1-Aminocyclopropane-1-Carboxylate Synthase Transcription via WRKY33 and 1-Aminocyclopropane-1-Carboxylate Oxidase by Modulating Messenger RNA Stability to Induce Ethylene Synthesis during Stress. Plant Physiol., 2015. 169(4): p. 2963-81 [PMID:26463088] Daumann M,Fischer M,Niopek-Witz S,Girke C,Möhlmann T Apoplastic Nucleoside Accumulation in Arabidopsis Leads to Reduced Photosynthetic Performance and Increased Susceptibility Against Botrytis cinerea. Front Plant Sci, 2015. 6: p. 1158 [PMID:26779190] Liu S,Bartnikas LM,Volko SM,Ausubel FM,Tang D Mutation of the Glucosinolate Biosynthesis Enzyme Cytochrome P450 83A1 Monooxygenase Increases Camalexin Accumulation and Powdery Mildew Resistance. Front Plant Sci, 2016. 7: p. 227 [PMID:26973671] Jiang Y,Yu D The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance. Plant Physiol., 2016. 171(4): p. 2771-82 [PMID:27268959] Liao CJ,Lai Z,Lee S,Yun DJ,Mengiste T Arabidopsis HOOKLESS1 Regulates Responses to Pathogens and Abscisic Acid through Interaction with MED18 and Acetylation of WRKY33 and ABI5 Chromatin. Plant Cell, 2016. 28(7): p. 1662-81 [PMID:27317674] Birkenbihl RP,Kracher B,Roccaro M,Somssich IE Induced Genome-Wide Binding of Three Arabidopsis WRKY Transcription Factors during Early MAMP-Triggered Immunity. Plant Cell, 2017. 29(1): p. 20-38 [PMID:28011690] Nguyen CC, et al. Overexpression of oligouridylate binding protein 1b results in ABA hypersensitivity. Plant Signal Behav, 2017. 12(2): p. e1282591 [PMID:28112571] Liu S,Ziegler J,Zeier J,Birkenbihl RP,Somssich IE Botrytis cinerea B05.10 promotes disease development in Arabidopsis by suppressing WRKY33-mediated host immunity. Plant Cell Environ., 2017. 40(10): p. 2189-2206 [PMID:28708934] D'Ambrosio JM, et al. Phospholipase C2 Affects MAMP-Triggered Immunity by Modulating ROS Production. Plant Physiol., 2017. 175(2): p. 970-981 [PMID:28827453] Liu F, et al. Interactions of WRKY15 and WRKY33 transcription factors and their roles in the resistance of oilseed rape to Sclerotinia infection. Plant Biotechnol. J., 2018. 16(4): p. 911-925 [PMID:28929638] Crespo-Salvador Ó,Escamilla-Aguilar M,López-Cruz J,López-Rodas G,González-Bosch C Determination of histone epigenetic marks in Arabidopsis and tomato genes in the early response to Botrytis cinerea. Plant Cell Rep., 2018. 37(1): p. 153-166 [PMID:29119291]