PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj0g3v0272799.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 176aa MW: 19167.5 Da PI: 4.3277 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 65.7 | 7.3e-21 | 142 | 176 | 1 | 35 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---E CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvk 35 ldDgy+WrKYGqK+vkg+++prsYY+Ct agC+v+ Lj0g3v0272799.3 142 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCMVR 176 59******************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.2E-23 | 127 | 176 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.89E-19 | 134 | 176 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 24.398 | 137 | 176 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.1E-10 | 142 | 176 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.6E-15 | 143 | 176 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009555 | Biological Process | pollen development | ||||
GO:0009942 | Biological Process | longitudinal axis specification | ||||
GO:0030010 | Biological Process | establishment of cell polarity | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MQVDNPEHVE PQRVGEGDLG WADAQKGNIA GAGNWKQDNL EVTSSASVGP EYGNQSTNLQ 60 TQNGTNLDSG EAVDGSSTFS NEEEEDDQGT HGSVSLGYDG EGDESESKRR KLESYATELS 120 GATRAIREPR VVVQTTSEVD ILDDGYRWRK YGQKVVKGNP NPRSYYKCTN AGCMVR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-22 | 133 | 176 | 8 | 51 | Probable WRKY transcription factor 4 |
2lex_A | 1e-22 | 133 | 176 | 8 | 51 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Low expression in senescent leaves (PubMed:11722756). Expressed in both the unfertilized egg cell and the pollen tube (PubMed:21316593). {ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:21316593}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00071 | PBM | Transfer from AT5G56270 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj0g3v0272799.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004499679.1 | 1e-111 | probable WRKY transcription factor 2 isoform X2 | ||||
Refseq | XP_012571036.1 | 1e-111 | probable WRKY transcription factor 2 isoform X1 | ||||
Swissprot | Q9FG77 | 1e-54 | WRKY2_ARATH; Probable WRKY transcription factor 2 | ||||
TrEMBL | A0A1S2Y5I8 | 1e-109 | A0A1S2Y5I8_CICAR; probable WRKY transcription factor 2 isoform X2 | ||||
TrEMBL | A0A1S3E7Q7 | 1e-109 | A0A1S3E7Q7_CICAR; probable WRKY transcription factor 2 isoform X1 | ||||
STRING | XP_004499679.1 | 1e-110 | (Cicer arietinum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G56270.1 | 5e-57 | WRKY DNA-binding protein 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|