PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lj0g3v0226409.2

Organism

Lotus japonicus

Taxonomic ID

34305

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

MYB_related

Protein Properties

Length: 121aa MW: 14154.4 Da PI: 8.4253

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj0g3v0226409.2	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	24.1	8.3e-08	66	107	4	46
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 WT+eE + l d+++++ + + Ia +++ Rt +++k+r+++ Lj0g3v0226409.2 66 WTKEETDELFDLCERFDLR-FIVIADRFPSSRTVEELKDRYYS 107 *****************.*******************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF16282	6.3E-32	39	112	IPR032563	DAMP1, SANT/Myb-like domain
SuperFamily	SSF46689	1.71E-7	57	112	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	5.1E-7	60	110	IPR009057	Homeodomain-like
SMART	SM00717	6.1E-6	62	111	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 121 aa Download sequence Send to blast
MKRSLGNGFL SPVLLVKIIF NYTIGFVLSM VFRLQGIISF AKYNKSVDII RYTDEEYDKH 60 LTNPMWTKEE TDELFDLCER FDLRFIVIAD RFPSSRTVEE LKDRYYSVSR AILIARAPSL 120 G

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3hm5_A	7e-20	40	117	7	88	DNA methyltransferase 1-associated protein 1
4iej_A	7e-20	40	117	7	88	DNA methyltransferase 1-associated protein 1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Lja.7298	0.0	floral bud\| pod\| root

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305\|Ref.5}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj0g3v0226409.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT094886	1e-111	BT094886.1 Soybean clone JCVI-FLGm-25A17 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027925468.1	9e-50	SWR1-complex protein 4
Refseq	XP_027925475.1	9e-50	SWR1-complex protein 4
Swissprot	Q8VZL6	3e-40	SWC4_ARATH; SWR1-complex protein 4
TrEMBL	A0A445FJY8	2e-48	A0A445FJY8_GLYSO; SWR1-complex protein 4 isoform G
TrEMBL	A0A4D6MBH0	2e-48	A0A4D6MBH0_VIGUN; DNA methyltransferase 1-associated protein 1
STRING	GLYMA19G40630.1	4e-49	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47210.1	1e-42	MYB_related family protein

Publications ? help Back to Top
Gómez-Zambrano Á, et al. Arabidopsis SWC4 Binds DNA and Recruits the SWR1 Complex to Modulate Histone H2A.Z Deposition at Key Regulatory Genes. Mol Plant, 2018. 11(6): p. 815-832 [PMID:29604400]