PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lj0g3v0213049.1

Organism

Lotus japonicus

Taxonomic ID

34305

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

CPP

Protein Properties

Length: 247aa MW: 28165.7 Da PI: 9.4962

Description

CPP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj0g3v0213049.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCR	21.3	5.4e-07	91	123	3	36
TCR 3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedC 36 +gC+C ks+C ++ C Cfaa+++C+ C +C Lj0g3v0213049.1 91 FRGCQCAKSQCRNRHCPCFAANRECDP-DVCRNC 123 689**********************99.568888 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51633	21.401	37	140	IPR026489	CXC domain
Gene3D	G3DSA:2.170.270.10	6.4E-46	45	247	No hit	No description
SuperFamily	SSF82199	3.46E-41	50	247	No hit	No description
SMART	SM01114	1.1E-9	89	126	IPR033467	Tesmin/TSO1-like CXC domain
Pfam	PF03638	2.7E-4	92	123	IPR005172	CRC domain
SMART	SM00317	4.0E-7	154	247	IPR001214	SET domain
PROSITE profile	PS50280	10.091	154	247	IPR001214	SET domain
Pfam	PF00856	8.6E-5	165	240	IPR001214	SET domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005515	Molecular Function	protein binding

Sequence ? help Back to Top
Protein Sequence Length: 247 aa Download sequence Send to blast
MLIVLIFLLD QKKPQRSRLL WKKKKTKKFR HASKSGLPST WTRINKGKHH IFKQYTPCEC 60 QGMCGKQCPC IQAGTCCEKY CGCSKLCRNR FRGCQCAKSQ CRNRHCPCFA ANRECDPDVC 120 RNCWISCGDG SLGEPPRRED GQCGNMLLLL RQRQRILLGK SDIAGWGAFL KHPVNKNDFL 180 GEYTGELVSD TEADERGKVY YKINTSYIFN LNDQYALDAY RKGNKLKFAN HSSKPNCYAK 240 VLLVAGD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4mi0_A	9e-60	55	247	1	186	Histone-lysine N-methyltransferase EZH2
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	10	27	QKKPQRSRLLWKKKKTKK

Functional Description ? help Back to Top
Source	Description
UniProt	Polycomb group (PcG) protein. Catalytic subunit of some PcG multiprotein complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target genes. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj0g3v0213049.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018842481.1	1e-130	PREDICTED: histone-lysine N-methyltransferase EZ3-like isoform X8
Refseq	XP_018842483.1	1e-130	PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform X10
Swissprot	Q9ZSM8	1e-120	EZA1_ARATH; Histone-lysine N-methyltransferase EZA1
TrEMBL	A0A2I4GF06	1e-128	A0A2I4GF06_JUGRE; Histone-lysine N-methyltransferase
TrEMBL	A0A2I4GF07	1e-129	A0A2I4GF07_JUGRE; Histone-lysine N-methyltransferase
STRING	GLYMA02G01540.2	1e-128	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF972	3	3

Publications ? help Back to Top
Luo M,Bilodeau P,Dennis ES,Peacock WJ,Chaudhury A Expression and parent-of-origin effects for FIS2, MEA, and FIE in the endosperm and embryo of developing Arabidopsis seeds. Proc. Natl. Acad. Sci. U.S.A., 2000. 97(19): p. 10637-42 [PMID:10962025] Springer NM, et al. Comparative analysis of SET domain proteins in maize and Arabidopsis reveals multiple duplications preceding the divergence of monocots and dicots. Plant Physiol., 2003. 132(2): p. 907-25 [PMID:12805620] Chanvivattana Y, et al. Interaction of Polycomb-group proteins controlling flowering in Arabidopsis. Development, 2004. 131(21): p. 5263-76 [PMID:15456723] Wang D,Tyson MD,Jackson SS,Yadegari R Partially redundant functions of two SET-domain polycomb-group proteins in controlling initiation of seed development in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2006. 103(35): p. 13244-9 [PMID:16924116] Spillane C, et al. Positive darwinian selection at the imprinted MEDEA locus in plants. Nature, 2007. 448(7151): p. 349-52 [PMID:17637669] Johnston AJ,Matveeva E,Kirioukhova O,Grossniklaus U,Gruissem W A dynamic reciprocal RBR-PRC2 regulatory circuit controls Arabidopsis gametophyte development. Curr. Biol., 2008. 18(21): p. 1680-6 [PMID:18976913] Aichinger E, et al. CHD3 proteins and polycomb group proteins antagonistically determine cell identity in Arabidopsis. PLoS Genet., 2009. 5(8): p. e1000605 [PMID:19680533] Almada R, et al. Epigenetic repressor-like genes are differentially regulated during grapevine (Vitis vinifera L.) development. Plant Cell Rep., 2011. 30(10): p. 1959-68 [PMID:21681473] He C,Chen X,Huang H,Xu L Reprogramming of H3K27me3 is critical for acquisition of pluripotency from cultured Arabidopsis tissues. PLoS Genet., 2012. 8(8): p. e1002911 [PMID:22927830] Lindner M, et al. TAF13 interacts with PRC2 members and is essential for Arabidopsis seed development. Dev. Biol., 2013. 379(1): p. 28-37 [PMID:23506837] Footitt S,Müller K,Kermode AR,Finch-Savage WE Seed dormancy cycling in Arabidopsis: chromatin remodelling and regulation of DOG1 in response to seasonal environmental signals. Plant J., 2015. 81(3): p. 413-25 [PMID:25439058] Liang SC, et al. Kicking against the PRCs - A Domesticated Transposase Antagonises Silencing Mediated by Polycomb Group Proteins and Is an Accessory Component of Polycomb Repressive Complex 2. PLoS Genet., 2015. 11(12): p. e1005660 [PMID:26642436] Xu M,Hu T,Smith MR,Poethig RS Epigenetic Regulation of Vegetative Phase Change in Arabidopsis. Plant Cell, 2016. 28(1): p. 28-41 [PMID:26704382] Wang H, et al. Arabidopsis Flower and Embryo Developmental Genes are Repressed in Seedlings by Different Combinations of Polycomb Group Proteins in Association with Distinct Sets of Cis-regulatory Elements. PLoS Genet., 2016. 12(1): p. e1005771 [PMID:26760036] de Lucas M, et al. Transcriptional Regulation of Arabidopsis Polycomb Repressive Complex 2 Coordinates Cell-Type Proliferation and Differentiation. Plant Cell, 2016. 28(10): p. 2616-2631 [PMID:27650334] Xu Y, et al. Regulation of Vegetative Phase Change by SWI2/SNF2 Chromatin Remodeling ATPase BRAHMA. Plant Physiol., 2016. 172(4): p. 2416-2428 [PMID:27803189] Oliva M, et al. FIE, a nuclear PRC2 protein, forms cytoplasmic complexes in Arabidopsis thaliana. J. Exp. Bot., 2016. 67(21): p. 6111-6123 [PMID:27811080] Wang H, et al. Correction: Arabidopsis Flower and Embryo Developmental Genes are Repressed in Seedlings by Different Combinations of Polycomb Group Proteins in Association with Distinct Sets of Cis-regulatory Elements. PLoS Genet., 2017. 13(1): p. e1006574 [PMID:28122004] Zhou Y,Romero-Campero FJ,Gómez-Zambrano Á,Turck F,Calonje M H2A monoubiquitination in Arabidopsis thaliana is generally independent of LHP1 and PRC2 activity. Genome Biol., 2017. 18(1): p. 69 [PMID:28403905] Zhou Y, et al. Ctf4-related protein recruits LHP1-PRC2 to maintain H3K27me3 levels in dividing cells in Arabidopsis thaliana. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(18): p. 4833-4838 [PMID:28428341] Qiu Y,Liu SL,Adams KL Concerted Divergence after Gene Duplication in Polycomb Repressive Complexes. Plant Physiol., 2017. 174(2): p. 1192-1204 [PMID:28455403] Kim DH,Xi Y,Sung S Modular function of long noncoding RNA, COLDAIR, in the vernalization response. PLoS Genet., 2017. 13(7): p. e1006939 [PMID:28759577]