PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj0g3v0178269.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 68aa MW: 7451.17 Da PI: 3.7498 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 31.8 | 3.6e-10 | 37 | 67 | 2 | 32 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES- CS HSF_DNA-bind 2 Flkklyeiledeelkeliswsengnsfvvld 32 Fl+k+y+++ed++++++isw+++g++f+v++ Lj0g3v0178269.1 37 FLTKTYQLVEDQSIDDVISWNDDGSTFIVWN 67 9*****************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 2.4E-10 | 28 | 68 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 1.02E-8 | 34 | 68 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 9.3E-7 | 37 | 67 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 68 aa Download sequence Send to blast |
MAPPPPPPPP VEQHNADSYS PAAASSLESQ RSIPTPFLTK TYQLVEDQSI DDVISWNDDG 60 STFIVWNP |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.13024 | 1e-106 | cell culture| protoplast |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj0g3v0178269.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017438576.1 | 7e-26 | PREDICTED: heat stress transcription factor B-2a-like | ||||
Refseq | XP_027924957.1 | 7e-26 | heat stress transcription factor B-2a-like | ||||
Swissprot | Q9SCW4 | 2e-18 | HFB2A_ARATH; Heat stress transcription factor B-2a | ||||
TrEMBL | A0A0L9VIV6 | 2e-24 | A0A0L9VIV6_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3TBP5 | 2e-24 | A0A0S3TBP5_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A4D6M0Z7 | 2e-24 | A0A4D6M0Z7_VIGUN; Heat shock transcription factor | ||||
STRING | XP_007152318.1 | 5e-24 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1592 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62020.1 | 6e-21 | heat shock transcription factor B2A |
Publications ? help Back to Top | |||
---|---|---|---|
|