PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj0g3v0160319.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 141aa MW: 15871.2 Da PI: 10.0496 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.2 | 9.1e-19 | 53 | 99 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT++Ed+ll avk + g++W++Ia++++ gRt+ qc +rwqk+l Lj0g3v0160319.1 53 KGGWTEQEDKLLTSAVKAFNGKNWRKIAACVP-GRTDVQCLHRWQKVL 99 688*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 38.9 | 2e-12 | 105 | 140 | 1 | 37 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37 +g+WT+eEd+l+ ++v G+++W+ Ia+ ++ gR + Lj0g3v0160319.1 105 KGPWTKEEDDLIRELVMTNGKKNWSEIAKALP-GRIG 140 79******************************.*976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.661 | 48 | 103 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.77E-24 | 51 | 138 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.8E-15 | 52 | 101 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-16 | 53 | 99 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.9E-21 | 55 | 103 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.66E-14 | 56 | 99 | No hit | No description |
SMART | SM00717 | 0.052 | 104 | 141 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 16.197 | 104 | 141 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.8E-16 | 104 | 141 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.2E-11 | 105 | 141 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.87E-9 | 107 | 138 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MEHVIEQGGD AGMKMETLVS SFPESESRVD RGTYYKPVSF PGRVTGPTRR STKGGWTEQE 60 DKLLTSAVKA FNGKNWRKIA ACVPGRTDVQ CLHRWQKVLN PELIKGPWTK EEDDLIRELV 120 MTNGKKNWSE IAKALPGRIG K |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 2e-28 | 1 | 141 | 6 | 142 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 2e-28 | 1 | 141 | 6 | 142 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.21736 | 0.0 | cell culture |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Accumulates in the columella root cap. Also present in floral organs in young flower buds. Strongly expressed in vascular tissues of filaments and anthers. Weakly and uniformly present in the developing embryo and maternal tissues (PubMed:17287251). Expressed both in proliferating and maturing stages of leaves (PubMed:26069325). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:26069325}. | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the root quiescent center (PubMed:15937229). Accumulates in division zone of primary root tips and emerging lateral roots. Also present in floral organs in young flower buds. Weakly and uniformly present in the developing embryo and maternal tissues (PubMed:17287251). Expressed specifically in proliferating stage of leaves (PubMed:26069325). {ECO:0000269|PubMed:15937229, ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:26069325}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, cotyledons and leaves, especially in vascular tissues, and in flowers. {ECO:0000269|PubMed:17287251}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed ubiquitously at low levels (PubMed:10743663). Expressed in roots, cotyledons, flowers and leaves, especially in vascular tissues (PubMed:17287251). {ECO:0000269|PubMed:10743663, ECO:0000269|PubMed:17287251}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669, PubMed:25806785). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:25806785}.; FUNCTION: Involved in transcription regulation during induced endoreduplication at the powdery mildew (e.g. G.orontii) infection site, thus promoting G.orontii growth and reproduction. {ECO:0000269|PubMed:20018666}. | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Transcription activator involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:26069325}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj0g3v0160319.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Constant levels during cell cycle. Activated by CYCB1. {ECO:0000269|PubMed:17287251}. | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (SA) (PubMed:16463103). Expressed in a cell cycle-dependent manner, with highest levels 2 hours before the peak of mitotic index in cells synchronized by aphidicolin. Activated by CYCB1 (PubMed:17287251). Accumulates at powdery mildew (e.g. G.orontii) infected cells. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17287251}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018813885.1 | 3e-55 | PREDICTED: myb-related protein 3R-1-like isoform X1 | ||||
Swissprot | Q94FL9 | 7e-41 | MB3R4_ARATH; Transcription factor MYB3R-4 | ||||
Swissprot | Q9S7G7 | 6e-41 | MB3R1_ARATH; Transcription factor MYB3R-1 | ||||
TrEMBL | A0A2I4E3B0 | 6e-54 | A0A2I4E3B0_JUGRE; myb-related protein 3R-1-like isoform X1 | ||||
STRING | cassava4.1_033700m | 3e-52 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14976 | 13 | 14 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11510.2 | 8e-44 | myb domain protein 3r-4 |
Publications ? help Back to Top | |||
---|---|---|---|
|