PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj0g3v0139469.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 178aa MW: 19547.3 Da PI: 6.9034 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 23.3 | 1.3e-07 | 4 | 33 | 5 | 34 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeH 34 C+ +e+ ++ fC ++ lC C ++ H Lj0g3v0139469.1 4 LCDACESAAAIVFCAADEAALCSACDEKVH 33 7***************************99 PP | |||||||
2 | zf-B_box | 30.2 | 9.5e-10 | 52 | 86 | 2 | 36 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeHkg 36 + ++C+ +e+ ++ ++Ce++++ lC +C H g Lj0g3v0139469.1 52 DVPRCDICENAPAFFYCETDGTSLCLQCDIIVHVG 86 6799*************************998855 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00336 | 3.9E-8 | 1 | 47 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 10.367 | 1 | 47 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 4.8E-6 | 3 | 46 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 1.72E-6 | 3 | 47 | No hit | No description |
SuperFamily | SSF57845 | 7.63E-6 | 48 | 86 | No hit | No description |
PROSITE profile | PS50119 | 9.101 | 51 | 96 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 6.7E-11 | 51 | 96 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 5.2E-8 | 52 | 85 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 2.68E-7 | 54 | 84 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005622 | Cellular Component | intracellular | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MRTLCDACES AAAIVFCAAD EAALCSACDE KVHMCNKLAS RHVRVSLASP SDVPRCDICE 60 NAPAFFYCET DGTSLCLQCD IIVHVGGKRT HGRYLLFRQR IEFPGDKPGH AESPVSHPLN 120 PGGTKRGANP LPQMKLGEIQ QNHRMVPSSE ADAMRETKMI DLNMKPHKID EQTSNNQP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as negative regulator of seedling photomorphogenesis. {ECO:0000269|PubMed:18540109}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj0g3v0139469.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015964224.1 | 1e-106 | B-box zinc finger protein 18 | ||||
Refseq | XP_016201935.1 | 1e-106 | B-box zinc finger protein 18 isoform X2 | ||||
Refseq | XP_025653559.1 | 1e-106 | B-box zinc finger protein 18 isoform X2 | ||||
Refseq | XP_025698969.1 | 1e-106 | B-box zinc finger protein 18 isoform X2 | ||||
Swissprot | C0SVM5 | 2e-69 | BBX19_ARATH; B-box zinc finger protein 19 | ||||
TrEMBL | A0A444Z9A5 | 1e-105 | A0A444Z9A5_ARAHY; Uncharacterized protein | ||||
STRING | GLYMA01G37370.1 | 1e-105 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2734 | 33 | 70 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38960.1 | 6e-72 | DBB family protein |