PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj0g3v0139439.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 143aa MW: 15700.8 Da PI: 9.2913 | ||||||||
Description | BBR-BPC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 269.7 | 1.5e-82 | 27 | 143 | 185 | 301 |
GAGA_bind 185 erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGyd 278 ska++k +dl+ln+v++Dest+P+PvCsCtG+lrqCYkWGnGGWqS+CCttt+S+yPLP+++++r+aR++grKmS++af+klL++LaaeG+d Lj0g3v0139439.1 27 GVSKADWKGQDLGLNQVAYDESTMPAPVCSCTGVLRQCYKWGNGGWQSSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEGHD 120 349******************************************************************************************* PP GAGA_bind 279 lsnpvDLkdhWAkHGtnkfvtir 301 lsnpvDLkdhWAkHGtn+++ti+ Lj0g3v0139439.1 121 LSNPVDLKDHWAKHGTNRYITIK 143 **********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01226 | 1.1E-58 | 1 | 143 | IPR010409 | GAGA-binding transcriptional activator |
Pfam | PF06217 | 1.7E-78 | 23 | 143 | IPR010409 | GAGA-binding transcriptional activator |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MMFGKGHDWK SGQEMVNGGD DLNRQLGVSK ADWKGQDLGL NQVAYDESTM PAPVCSCTGV 60 LRQCYKWGNG GWQSSCCTTT LSMYPLPAVP NKRHARVGGR KMSGSAFSKL LSRLAAEGHD 120 LSNPVDLKDH WAKHGTNRYI TIK |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.13867 | 0.0 | cell culture |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal vasculature, in young rosette, in the lateral and tip of primary roots, and in ovule at the exception of the outer integument. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj0g3v0139439.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT093610 | 1e-151 | BT093610.1 Soybean clone JCVI-FLGm-24C8 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001242458.2 | 1e-101 | basic pentacysteine 6 | ||||
Refseq | XP_006577804.1 | 1e-101 | basic pentacysteine 6 isoform X1 | ||||
Swissprot | Q8L999 | 1e-74 | BPC6_ARATH; Protein BASIC PENTACYSTEINE6 | ||||
TrEMBL | C6T8J3 | 1e-99 | C6T8J3_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA04G02860.1 | 1e-100 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6905 | 34 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G42520.3 | 2e-77 | basic pentacysteine 6 |