PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj0g3v0122049.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 98aa MW: 10979.6 Da PI: 4.3897 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 80.3 | 2.5e-25 | 11 | 92 | 3 | 84 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84 ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +v+se+++ c re+r+ti+++ +l al+ lGf dy+e++ Lj0g3v0122049.3 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESNEVCGREERRTIAPEHVLKALGVLGFGDYIEEVY 92 6899**************************************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.0E-33 | 8 | 97 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.84E-29 | 12 | 97 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.6E-22 | 14 | 79 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MEPMDIVAKA KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLVSSESNE 60 VCGREERRTI APEHVLKALG VLGFGDYIEE VYAAYEQH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 7e-29 | 12 | 91 | 12 | 90 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.7050 | 1e-166 | cell culture| pod| root |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj0g3v0122049.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT141060 | 1e-163 | BT141060.1 Lotus japonicus clone JCVI-FLLj-2C22 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014494002.1 | 2e-65 | protein Dr1 homolog | ||||
Refseq | XP_017422009.1 | 2e-65 | PREDICTED: protein Dr1 homolog | ||||
Swissprot | P49592 | 1e-61 | NC2B_ARATH; Protein Dr1 homolog | ||||
TrEMBL | I3SKR2 | 5e-66 | I3SKR2_LOTJA; Uncharacterized protein | ||||
STRING | XP_007138352.1 | 2e-64 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23090.2 | 5e-64 | nuclear factor Y, subunit B13 |
Publications ? help Back to Top | |||
---|---|---|---|
|